KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF718635Help
Entry
PFLUOLIPICF718635 CDS       T03767                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pff  Pseudomonas fluorescens PICF7
Brite
KEGG Orthology (KO) [BR:pff00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFLUOLIPICF718635
Enzymes [BR:pff01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PFLUOLIPICF718635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DUF43
Motif
Other DBs
NCBI-ProteinID: AJZ95324
LinkDB All DBs
Position
4007558..4008637
Genome map
AA seq 359 aa AA seqDB search
MDKHTEMQAVVCHGPKDYRLERIGKPQARANELVIRIAACGICASDCKCHSGAAMFWGGD
NPWVKAPVVPGHEFFGYVVEAGEGAEEHFEVAVGDKVIAEQIVPCGKCRFCKSGKYWMCE
VHNIFGFQREVAEGGMAQYMRIPKTAIVHKIPESVSLEDSALVEPMACSIHTVNRGDIQL
DDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLELAKKFGADVVINPSRDNAREI
INGLTDNYGCDVYIETTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSVDWSIIGDRKELD
VRGAHLGPYCYPIAIDLFERGLVTSKGIVTHDFPLDDWAEAFELANSTKSIKVLLKPVV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcacaccgaaatgcaagccgtcgtctgccacggccccaaagactatcgcctg
gaacgcatcggcaaaccccaggcacgcgccaatgaactggtgatccgcatcgccgcctgc
ggcatatgcgccagtgactgcaagtgccactcgggcgcagcgatgttctggggcggcgac
aacccgtgggtcaaggcgccggtggtgccgggccacgagtttttcggctatgtggtggaa
gcgggcgagggcgccgaagagcacttcgaagtcgcggtgggcgacaaggtgatcgccgaa
cagatcgtgccgtgcggtaagtgccgtttctgcaagtcgggcaagtattggatgtgcgaa
gtgcacaacatcttcggcttccagcgtgaagtggccgaaggcggcatggcccagtacatg
cggattcccaagaccgccatcgtgcataaaatccccgagtcggtgtcgctggaagactcg
gcgctggtggaaccgatggcctgttccatccataccgtcaaccgcggcgatatccagctc
gatgacgtggtggtgatcgccggtgccggcacccttggcctgtgcatggtccaggtcgct
gcgttgaagacgccgaagaaactggtggtgatcgacatggtcgacgagcgcctggaactg
gcgaagaagttcggcgccgatgtggtgatcaacccgtcgcgggacaacgcccgcgagatc
atcaatggcctgaccgacaactatggctgcgacgtgtacatcgaaaccaccggcgttccg
gccggcgtgacccaggggctggacctgatccgcaagctcgggcgttttgtcgagttcagc
gtgtttggtgccgagaccagcgtcgactggtcgatcattggcgatcgcaaggagttggac
gtacgcggcgcccacctcgggccgtattgctacccgatcgccatcgacctgttcgagcgc
ggcctggtcacgtccaagggcatcgttacccatgacttcccgctggacgactgggccgaa
gccttcgagctggcgaactcgaccaagtcgatcaaggtgctgttgaagccggtggtctga

DBGET integrated database retrieval system