KEGG   Pseudomonas fluorescens PICF7: PFLUOLIPICF726360Help
Entry
PFLUOLIPICF726360 CDS       T03767                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pff  Pseudomonas fluorescens PICF7
Pathway
pff00010  Glycolysis / Gluconeogenesis
pff00052  Galactose metabolism
pff01100  Metabolic pathways
pff01110  Biosynthesis of secondary metabolites
pff01120  Microbial metabolism in diverse environments
pff01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pff00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFLUOLIPICF726360
   00052 Galactose metabolism
    PFLUOLIPICF726360
Enzymes [BR:pff01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PFLUOLIPICF726360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AJZ96504
LinkDB All DBs
Position
5697602..5698750
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLALSMLVASGGAQAAGLTSEHKPFGKTNDGTAVEQYVLRNSHGMQATVIT
YGGVLQSLKVPDKHGKVEDVVLGFDDVQGYQSGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKHVWKATPVKAKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDNNELHIDYTATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGKLAPVKGTPMDFLKPTPIGQHIKDDHPQLKFAEPKQGGFDFNWALDTKGDVKQLAAEV
HDPESGRRLQLFTTEPGVQFYTSNFLDGSVKGKAGKTYLHWSGFTLETQHFPDAPNQPKF
ASTRLNPGQTYTQNTVFKFSAD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgttacctgctctccggcctcgccctgtccatgctggtcgccagtggc
ggcgcccaggctgcaggccttaccagcgagcacaaacctttcggtaaaaccaacgacggc
accgccgtcgaacagtacgtgttgcgcaacagccatggcatgcaagccacggtgattacc
tacggcggcgtgttgcagtcgctgaaggtgccggacaagcacggcaaggtcgaggacgtg
gtgctgggcttcgacgacgtgcagggctatcaaagcggtacggcgtttttcggcgcgacc
atcgggcgcttcggcaatcgcctcgcgggcggtgccttcgagctcgacggcaagcgttac
caggttccgctcaacgatggccccaactcgctgcatggcggcgcccagggcttcgacaag
cacgtatggaaagccacgcccgtcaaggccaaggactccgtgggcgtgaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggcaacctgaagaccgaggtcacctaccgc
ctcaacgacaacaacgaactgcacatcgattacaccgccaccaccgacaaacccacggtg
ctcaacctcaccaaccacagctacttcaacctcgccggtgcgggcaatggcgacatcctc
aagcaagtcgctaccttgcatgccagtcattacacgccggtgaatgccaccttgatccct
accggcaaactggcacctgtcaaaggcacgccgatggacttcctcaagcccacgccgatc
ggccagcacatcaaggacgatcacccgcagctcaaattcgccgagccgaaacagggaggg
ttcgacttcaactgggcgctggataccaaaggtgatgtgaaacagcttgcggccgaggtg
catgatcctgagtccggacggcgtttgcagctgtttaccacggagcctggggtgcagttc
tacaccagcaacttcctggatgggtcggtgaagggcaaggctgggaagacctacctgcac
tggagcgggttcacgctggagacccagcattttccagatgcgcccaaccaacccaagttt
gcctcgacccgcctgaacccagggcagacttacacccagaacaccgtcttcaaattctcc
gccgattaa

DBGET integrated database retrieval system