KEGG   Pseudomonas simiae PICF7: PFLUOLIPICF727285
Entry
PFLUOLIPICF727285 CDS       T03767                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11208  GST-like protein
Organism
pff  Pseudomonas simiae PICF7
Brite
KEGG Orthology (KO) [BR:pff00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    PFLUOLIPICF727285
SSDB
Motif
Pfam: GST_N GST_N_2 GST_N_3
Other DBs
NCBI-ProteinID: AJZ96658
LinkDB
Position
complement(5900150..5900782)
AA seq 210 aa
MYTLYGIDESGSCMIEIALQRCAVPWRRVDAASWAEGEGSDELARINPLKQVPTLITPDG
QVLTESAAILIHLGLEYPASDLLAGDRAQIIRGLVYIAANCYSAIGIIDYPQRWLGDVNE
TVQAQLVTGTRRYLHQAWVVFADQFDGQLFAPNGVPNALGVMAAAVSRWDEAREVLNGLA
PGFAQSLAQVDADPVVAPVFARHWPAWKVS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtacaccctttatggcatcgacgaatccggctcctgcatgatcgaaatcgccctacag
cgctgtgcggtgccgtggcgacgggtggacgcggcctcctgggcagagggtgagggcagt
gatgagctggcccggatcaacccgctcaagcaggtacccaccctgatcacccccgatggc
caggtgttgacggaaagcgccgcgatcctgatccacctgggcttggaatatccggcctcg
gacctgctggccggcgaccgcgcgcagatcatccgcggccttgtgtacatcgcggccaac
tgctattcggcgatcggcatcattgactacccgcaacgctggctcggcgacgtcaacgaa
accgtacaggcgcagctggtgacaggcactcgacgatacttgcaccaggcctgggtggtg
tttgccgatcagttcgatgggcagttgttcgcccctaacggcgtgccgaatgcgttgggc
gtgatggcggcggcggtgtcgcgttgggatgaagcgcgggaggtgttgaacggtctggcg
ccgggctttgcccaaagcctggcgcaagtggatgccgaccctgtcgtcgcccccgtattt
gcgcggcattggcccgcgtggaaggtctcatga

DBGET integrated database retrieval system