KEGG   Pandoraea faecigallinarum: AB870_16500Help
Entry
AB870_16500       CDS       T03972                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfg  Pandoraea faecigallinarum
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB870_16500
Enzymes [BR:pfg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB870_16500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored Thi4 Glutaredoxin NAD_binding_8 K_oxygenase FAD_binding_3 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AKM31375
UniProt: A0A0H3WUR5
LinkDB All DBs
Position
1104163..1105755
Genome map
AA seq 530 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKSLIDEIAPLSDKITVVSRDDARE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPLKLDDDTIAQIRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQITIDGALFQSEVEARQVMAVPTVFLNGES
FTQGRTSVKELLAKLDTGATARAAKALENRPVYDMLIVGGGPAGAAAAIYAARKGIVTGV
VAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVRTYDVDVIDTQRAQALIPGKIHE
VHLASGAVLKARAVVLATGARWREIGAPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGTQLRADEVLQRKLRSLSNVRVLTNAQTTEIVGDGQKV
NALVYRDRSTGETATIALEGVFVQIGLVPNTEWLGSTVSLSRHGEIEVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLGSVEDDVVATQREAAVA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtatctccagaaagtcacgcgcccc
atcgagatcgccgtgtggctggacgatagccccaagtccgccgaaatgaagtcgctgatc
gacgagatcgcaccgctctccgacaagatcaccgtcgtctcgcgcgacgacgcccgcgag
cgtcgtccctcgttcgcgatcggcacgccgggtgaggcaccgcgcatccgttttgccggt
ctgccgatggggcacgagttcacgtcgctggtgctggcgttgctgcaagtcggcggtcat
ccgctcaagctcgacgacgacaccattgcgcaaattcgcgcgctcgatggcgacttccgt
ttcgagacgtacatttcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
gtcatggcgctcatcaacccgcgcatccagcaaatcaccatcgacggggcgctattccag
agtgaagtcgaagcgcgacaggtgatggcggtgccgaccgtgtttctcaacggcgaatcg
ttcacccagggccgcaccagcgtgaaggaactgctggccaaactcgacacgggcgcaacg
gcccgcgccgcgaaggcgctcgagaaccggccggtctacgacatgctgattgtggggggc
gggccggccggtgctgcggccgcgatttacgcggcgcgaaagggcatcgtgacgggcgtc
gtcgccgagcgttttggcggtcaggtgctcgacacgatggccatcgagaacttcgtctcg
gtcacgcacaccgaagggccgaagttcgccaccgcgctggagcagcacgtaaggacgtac
gacgtggacgtgatcgacacgcagcgtgcccaagcgttgattccgggcaagattcacgaa
gtgcatctggccagcggcgccgttctcaaggcccgcgccgtggtgctggccacgggtgcc
cgctggcgcgaaatcggcgccccgggcgagcgcgaataccgcaaccgtggcgtggcgtac
tgcccgcactgcgatggtccgttgttcaaaggcaagcgcgttgcggtggtcggcggcggc
aactcgggcgtggaagcggctatcgacctggcgggcatcgtcaaggaagtcacgctaatc
gaatacggcacgcagttgcgcgccgacgaagtgctccagcgcaagctgcgcagtctgtcg
aacgtgcgggtactgacgaacgcgcagaccaccgagatcgtcggtgacggccagaaggtg
aacgctctggtgtaccgtgaccgctcgacgggcgagactgcgacgattgccctcgaaggc
gtgttcgtgcagatcggtctggtgccgaataccgaatggttggggagcacggtgtcgctc
tcgcgtcatggcgagatcgaagtcgatgcgaagggggcaacatccgtgccgggcgtattc
gccgcgggcgacgtcacgaccgtgccgttcaagcagatcgtgattgcggtcggtgaaggg
gccaaggcatcgctcggcgccttcgaacatctgatgctcggctcggtggaagatgacgtc
gtcgccacccagcgcgaagccgctgtcgcctga

DBGET integrated database retrieval system