KEGG   Pandoraea faecigallinarum: AB870_17370Help
Entry
AB870_17370       CDS       T03972                                 

Definition
(GenBank) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pfg01100  Metabolic pathways
pfg01110  Biosynthesis of secondary metabolites
pfg01130  Biosynthesis of antibiotics
pfg01230  Biosynthesis of amino acids
Module
pfg_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
pfg_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AB870_17370
Enzymes [BR:pfg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     AB870_17370
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     AB870_17370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT
Motif
Other DBs
NCBI-ProteinID: AKM31512
UniProt: A0A0H3WUV1
LinkDB All DBs
Position
1292309..1293391
Genome map
AA seq 360 aa AA seqDB search
MEDDLNASLRPLREKIDAIDAQLLKLLNQRAAIALEVGEVKKRFGAPVFRPERELQVISR
LQQANDGPLYGDNLASIWREIMSASRALEKVMTVAYLGPAGTYSEQASLAYFGQSVKGLP
CPSLDEVFRAVEAGSADFGVVPVENSTEGVVSRTLDLLLQSPLTIGGEVALPIHHNLMSR
SGTLDGVTRICSHAQSLAQCQHWLTAHFPNLERQAVSSNAEAARLAAADPAIAAIAGESA
ATQYGLQIAFSHVQDDPHNRTRFVVIGTQDPAPSGRDQTSLILSVPNRAGAVVALLEPLA
SNGVSMTRFESRPAKSGAWEYYFYVDFEGHRDDPNVAKALEALRQNAAYCKVLGSYPRSA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgatctgaacgcatcgctgcgcccattgcgcgagaaaatcgatgcaatcgac
gcgcaactgctcaagctgctcaatcaacgtgcggccatcgcccttgaagtcggcgaggtc
aagaagcgcttcggtgcgccggtgttccggcccgagcgcgaattgcaggtcatttcccga
ctgcaacaagccaacgacggccctttgtacggcgacaatctggcgtcgatctggcgtgaa
atcatgtcggccagccgtgcgctggaaaaagtcatgaccgtcgcgtatctcggtccggcg
ggcacgtacagcgagcaggcctcgctggcttactttggccaaagcgtgaagggcttgccg
tgtccctcgctcgacgaggtattccgcgccgtcgaggcggggagcgccgatttcggcgtt
gtaccggttgagaactccaccgaaggcgttgtgtcccgtacgctggacctgctgctgcaa
agtcccctgaccattggcggcgaagtggcattgccgattcaccacaacctgatgtcacgc
tccggcacgctcgacggcgtgacgcgaatctgctcgcacgcgcagtcgcttgcacagtgt
cagcactggctcacggcgcacttccccaatctcgaacgccaggccgtgtcgagcaacgcc
gaagccgcgcgcctggcggcagccgatcctgccatcgctgccatcgcaggggagtctgcg
gcgactcagtacggcctgcaaatcgcgttctcgcatgtacaggacgacccgcacaaccgc
acacgcttcgttgtgatcggcacgcaagatccggcgcccagcggccgcgatcagacgtcg
ctgatcctgtcggtgccgaatcgcgccggcgccgtggtcgcgttgcttgagccgttggcc
agcaatggcgtatcgatgacgcgcttcgagtcgcgtccggccaagagcggcgcctgggag
tattacttctacgtcgacttcgaaggccaccgggacgatccgaacgttgcaaaggccctt
gaggcgcttcgtcagaacgccgcctactgcaaggtgctcgggtcctacccgcgctccgcc
tga

DBGET integrated database retrieval system