KEGG   Pandoraea faecigallinarum: AB870_18110Help
Entry
AB870_18110       CDS       T03972                                 

Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00440  Phosphonate and phosphinate metabolism
pfg01100  Metabolic pathways
pfg01120  Microbial metabolism in diverse environments
pfg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    AB870_18110
Enzymes [BR:pfg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     AB870_18110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AKM31622
UniProt: A0A0H3WV68
LinkDB All DBs
Position
complement(1472541..1474253)
Genome map
AA seq 570 aa AA seqDB search
MNAPDAISLPPGATRAAQLRAMLRSNQLEFLMEAHNGISARIVREAGFKGIWASGLTISA
QFGVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGIAGVC
IEDKVFPKTNSFIGGERQPLADIDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEA
LRRAEAYRQAGADAILIHSKLKRADEIVQFAREWGNRCPLGIVPTKYYSTPTDVFREANI
SLVIWANHLLRAATSAMQSVAAEIHRNETLINVEDRVATVDEIFRLQDADEYSRAEDRYL
SAANAPRSAIVLAASRGKNLESVTTDRPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGG
YRADAIDTAGITLAINERHAETGELASLACVTNAFTQDTVISYGDLLFRSYIVRDLVESD
ADFTVVVDSTAAANAANAANASVRDFAYCSAGDDRGLFGQQVLLEKISGEAPDAGRTPNG
RWIGLLGVRGDAGRAQLQRVFAALQTRPDFDRLGMPELINALAADGARIEVQYVHGHWRG
VNDMDEFRRAADFAHGQTPLSAAASETHGD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcccgacgcaatctccctaccgccgggcgccacgcgcgcggcgcagctgcgc
gccatgctgcgcagcaaccagctcgaattcctgatggaagcgcataacggcatttccgcg
cgcatcgtgcgcgaagccggcttcaagggaatctgggcgtccggtctgaccatctcggcg
cagttcggtgttcgcgacaacaacgaagccagttggacacaggtcgtcgacaacctcgaa
ttcatggccgacgccagcgatctgccgatcctgctcgacggcgacaccggctacggcaac
ttcaacaacatgcggcgtctggtgcgcaagttggagcaacgcggcattgcgggcgtgtgc
atcgaagacaaggtcttccccaagacgaacagcttcattggcggcgaacgccagccgctg
gccgatatcgacgagttctgcggcaagatcaaggctggcaaggattcgcaggccgacgac
gacttctccatcgttgcccgtgtcgaagcgctgatcgccggctggggcatggaagaagcc
ctgcgccgtgccgaggcctatcgccaggcaggcgcggacgccatcctgattcacagcaag
ctcaagcgcgccgacgaaatcgtgcaattcgcgcgcgagtggggcaaccgctgcccgctg
ggaatcgtgccgacgaagtactacagcacgccgaccgacgtgtttcgcgaagccaatatc
agcctcgtgatctgggcgaaccatctgctgcgtgcggcgacttcggccatgcagtccgtc
gcggccgagatccatcgcaacgaaacgctgatcaatgtggaagaccgcgtggccacggtc
gacgagatcttccgcctgcaggacgccgacgaatactcgcgggccgaagaccgctatctg
tccgccgccaacgcgccgcgctcggccatcgtgctggccgcgagccgtggcaagaacctc
gagagcgtgacgacggaccggccgaaggtcatgctgccggtcgccggcaagccgctgctg
cgctggctggtcgacggcttcaaaaagcagggggtgaacgacatcacggtcgtgggcggc
tatcgcgccgacgccatcgacaccgccggcatcacgctcgcgatcaacgaacgccacgcc
gaaacgggtgaactggcctcgctcgcctgcgtgacgaacgccttcacgcaagacaccgtc
atctcatatggcgacctgctgttccgcagctacatcgtgcgcgatcttgtcgagagcgac
gccgactttaccgtcgtggtcgactccaccgccgcggccaatgcggccaatgcggccaac
gccagcgtgcgcgacttcgcgtattgctcggcgggcgacgaccgcggtctgttcgggcag
caggtgctgctcgagaaaatcagcggcgaagccccggatgccgggcgtaccccgaacggc
cgctggatcggtctgctgggcgtgcgcggcgacgccggccgtgcgcaattgcaacgtgtt
ttcgccgcgctgcaaacgcgccccgacttcgaccggctcggcatgccggaactcatcaac
gcactggccgccgacggcgcccggatcgaagtgcagtacgtacacggtcactggcgcggt
gtgaacgacatggacgaattccgccgcgcggccgacttcgctcatggccagacgccgctg
tccgccgccgcttcggagacgcatggtgattga

DBGET integrated database retrieval system