KEGG   Pandoraea faecigallinarum: AB870_21780Help
Entry
AB870_21780       CDS       T03972                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
pfg  Pandoraea faecigallinarum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh OmdA
Motif
Other DBs
NCBI-ProteinID: AKM32186
UniProt: A0A0H3X050
LinkDB All DBs
Position
2292009..2293442
Genome map
AA seq 477 aa AA seqDB search
MKTYDRFFIDGRWVTPVGRGTLDVFHSADGRLMGRIPEGAAEDAQAAVAAARKARDTWAA
TPAAERAGYLRKIAAGLKARTDELAQVMTGETGMPIKLVRAIQVGGPVYHWNNYAELAET
FEFEARVGNSLVVREPVGVVGAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPFNAF
ILAEVIAEAGLPAGVFNLVTGLGPVVGEVLARHPDVDMVSFTGSTRAGKRVSEVASQTVK
RVALELGGKSASVILDDADLAVAVKGTLNACYLNSGQTCSAHTRMLVPASRYDEIKALAK
DAVARFTLGDPREETTRLGPLASAAQQERVQTYIRKGLSEGAELIAGGDAVPAGFEAGFF
VQPTVLGRVTPDATVAQEEIFGPVLSIITYQDEADAVRIANDSIYGLGGAVWSGDEARAV
RVARQIRTGQVDINGGEFNVRAPFGGFKQSGHGRENGVYGFEEFLEYKSLQFKSAKS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtacgacaggtttttcattgacggacggtgggtaacaccggtcgggcgcggc
acgctggacgtttttcattcggccgacggcaggctgatgggccgcattcccgaaggtgcc
gccgaagacgcgcaagccgccgttgcggccgcgcgcaaggcacgtgacacgtgggcggcc
acaccggcggccgagcgtgccggttacctgcgcaagatcgctgcgggcctcaaggcacgc
accgacgaactggcgcaggtcatgacgggtgagacgggcatgccgatcaagctcgtgcgt
gccattcaggtcggtggtcctgtgtaccactggaacaactacgcggaactggcggaaacg
ttcgaattcgaggcgcgcgtgggtaattcgctcgtggtgcgcgagccggtgggggtggtc
ggtgcgattacgccgtggaactatccgcttaaccagatcacgttgaaagtggcgcctgcg
ctggcggcgggctgcaccgttgtgctgaagccatcggaggtggcgccgttcaatgccttc
attctggccgaggtcattgccgaagccggattgccggcgggcgttttcaatctggtgacg
gggctggggccggtcgtcggcgaggtgctcgcccggcatccggacgtcgacatggtgtcg
tttaccggttcgacgcgtgcgggcaagcgcgtgtcggaagtggcgtcgcaaacggtcaaa
cgtgtggcgctggagttggggggcaagtcggcgtcggtcattctcgacgatgcggatctt
gcggttgcggtgaaaggcacgcttaacgcctgctatttgaactcggggcagacttgctcg
gctcacacgcgcatgctggtgccggcatcgcgctatgacgagatcaaggcgctggcgaag
gacgccgtggcgcgtttcacgctgggggatccgcgtgaggaaacaacgcgtctcgggccg
ctggcttccgcggcacagcaagaacgtgtgcaaacgtatatccgcaaggggttgtccgaa
ggtgctgagttgatcgccgggggagacgcggtgccggcaggtttcgaggcgggctttttc
gtgcagccgaccgtgctcgggcgcgtaacgccggatgccacggtagcgcaagaagagatt
tttggccctgtactatcgatcattacgtatcaggatgaggccgatgcggtgcgcatcgcc
aacgactccatctacggtctgggcggggccgtatggtcaggcgacgaggcgcgcgccgtg
cgcgtggcgcgtcagatccggaccgggcaggtggacatcaacggcggggagttcaatgtg
cgggccccgttcggcggtttcaagcaatcggggcacggacgtgaaaacggcgtgtacggc
ttcgaggagtttcttgagtacaagtcgctccagttcaagtctgcgaagtcgtag

DBGET integrated database retrieval system