KEGG   Pandoraea faecigallinarum: AB870_22880Help
Entry
AB870_22880       CDS       T03972                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfg  Pandoraea faecigallinarum
Pathway
pfg00473  D-Alanine metabolism
pfg00550  Peptidoglycan biosynthesis
pfg01100  Metabolic pathways
pfg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AB870_22880
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AB870_22880
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AB870_22880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfg01011]
    AB870_22880
Enzymes [BR:pfg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AB870_22880
Peptidoglycan biosynthesis and degradation proteins [BR:pfg01011]
 Precursor biosynthesis
  Amino acid ligase
   AB870_22880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 TTL CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AKM32334
UniProt: A0A0H3WVU8
LinkDB All DBs
Position
2594875..2595330
Genome map
AA seq 151 aa AA seqDB search
MEVAGNDDFPIFLAAQYIHGKDLSVGIVEIERQPVVLPLLETKHDDQFYSYEVKSGKSPH
LHICPAEVSDSVEIEIKNQALAIYQELGCRGFARVDFILSNEKPWFLEVNTIPGLSRNGN
LSQMGAAFGWTYEDMIFHLISTIDDSFKYKP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgcggggaacgatgatttcccaatttttctcgccgcccaatacatccacgga
aaggacctcagcgttggaattgtcgaaatcgagcgtcaaccggtggtgctaccactactc
gagacaaaacatgatgaccagttttacagctacgaagtgaaaagtggaaagtcaccccac
ctccacatttgccccgccgaagttagcgattcagtcgaaatagaaataaaaaaccaggcc
ttagccatttaccaagaattgggatgcagaggatttgctcgcgtcgatttcattttatca
aatgaaaaaccatggtttcttgaggtaaacaccatccccggactttcgagaaatggaaat
ctttctcaaatgggcgccgcatttggctggacctacgaggatatgatcttccatttaata
tccacgatcgacgattcatttaaatacaagccgtaa

DBGET integrated database retrieval system