KEGG   Plasmodium falciparum HB3: PFHG_01386Help
Entry
PFHG_01386        CDS       T01052                                 

Definition
(Broad) histone deacetylase
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pfh  Plasmodium falciparum HB3
Brite
Enzymes [BR:pfh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PFHG_01386
Chromosome and associated proteins [BR:pfh03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PFHG_01386
   HDAC complexes
    Sin3A-HDAC complex
     PFHG_01386
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PFHG_01386
  Chromatin remodeling factors
   NuRD complex
    PFHG_01386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
LinkDB All DBs
AA seq 449 aa AA seqDB search
MSNRKKVAYFHDPDIGSYYYGAGHPMKPQRIRMTHSLIVSYNLYKYMEVYRPHKSDVNEL
TLFHDYEYIDFLSSISLENYREFTYQLKRFNVGEATDCPVFDGLFQFQQSCAGASIDGAS
KLNHHCADICVNWSGGLHHAKMSEASGFCYINDIVLGILELLKYHARVMYIDIDVHHGDG
VEEAFYVTHRVMTVSFHKFGDYFPGTGDITDVGVNHGKYYSVNVPLNDGMTDDAFVDLFK
VVIDKCVQTYRPGAIIIQCGADSLTGDRLGRFNLTIKGHARCVEHVRSYNIPLLVLGGGG
YTIRNVSRCWAYETGVVLNKHHEMPDQISLNDYYDYYAPDFQLHLQPSNIPNYNSPEHLS
RIKMKIAENLRHIEHAPGVQFSYVPPDFFNSDIDDESDKNQYELKDDSGGGRAPGTRAKE
HSTTHHLRRKNYDDDFFDLSDRDQSIVPY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatagaaaaaaggttgcctatttccatgaccccgatataggtagttattattat
ggagcaggtcatcctatgaagcctcaacgaatacgtatgacccattctttaatagtatct
tataatttatataaatatatggaagtgtataggcctcataaaagtgatgtaaatgagtta
accttatttcatgattatgaatacatagattttttgtcatctatatctttagaaaattat
cgagaatttacataccaattaaaaagatttaatgtaggagaagcaacggattgtcctgtg
tttgatggtctttttcaatttcagcaatcatgtgctggagcttcgatagatggagcttcc
aaattaaatcaccattgtgctgacatatgtgtgaattggtcaggaggattgcatcatgct
aaaatgtctgaagctagtggattttgttatataaatgatatagtattaggtatactagaa
ttattaaaatatcatgcacgtgtcatgtatatagatattgatgtacatcatggagatggt
gttgaggaagcattttatgtaacacatcgtgttatgacagtatcatttcataagtttggg
gattatttcccaggaacaggagatattacggatgttggtgttaaccatggaaaatattat
agtgtaaatgtgcctttaaatgatggtatgacagatgatgcttttgtagatttatttaaa
gttgtaatagataaatgtgttcaaacatatagaccaggagcaattattattcaatgtggt
gctgatagtttaacaggggatcgattgggtagatttaatttaactattaaaggtcatgcc
agatgtgtagaacacgtaaggtcatataatatacctttactcgttctaggtggtggtggt
tatactatacgtaatgtatcaagatgttgggcttacgaaacgggggttgtattaaataaa
catcatgaaatgcctgatcaaattagcttaaatgattattatgattattatgccccagat
ttccaattacacttacaaccatccaatatacctaattataactcacctgaacatttaagt
agaattaaaatgaaaatagcagaaaatctaagacacatagaacatgctccaggtgtccaa
ttttcctatgtccctcctgacttttttaattccgatattgatgatgaaagtgataaaaat
caatatgaattgaaagatgatagtggtggaggtagggcaccaggcacacgggcaaaggaa
cattcaaccacacatcatttgagaagaaaaaattacgacgatgatttttttgatttatct
gacagggatcaatctattgtaccatattaa

DBGET integrated database retrieval system