KEGG   Plasmodium falciparum HB3: PFHG_02483Help
Entry
PFHG_02483        CDS       T01052                                 

Definition
(Broad) fe-superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pfh  Plasmodium falciparum HB3
Pathway
pfh04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pfh00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PFHG_02483
Enzymes [BR:pfh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PFHG_02483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TetR_C_10
Motif
LinkDB All DBs
Structure
PDB: 

AA seq 198 aa AA seqDB search
MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKES
SGAIFNNAAQIWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFG
SGWGWLALNNNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRASYVKAWW
NLVNWNFANENLKKAMQK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggttattacattgcccaaattaaagtacgcattaaatgcattatcaccccatataagt
gaagagaccttaaatttccattataataaacatcatgcaggatacgtaaataaattaaat
accttaattaaggacacaccatttgctgaaaaatctttattagatatagtaaaagaatca
tcaggagctatttttaacaacgctgctcaaatatggaaccatactttttactgggattct
atgggacctgattgtggtggtgagcctcatggagaaattaaggaaaaaattcaagaagat
tttggatcttttaacaatttcaaagaacaattttccaatatattatgtggtcattttggt
tccggttggggatggttagctttaaataataataacaaattagttatattacaaacacat
gatgctggtaatccaattaaggataatacaggtattccaatattaacatgtgatatatgg
gagcatgcttattatattgattacagaaatgacagagcatcatatgttaaggcttggtgg
aacctagtaaattggaactttgcaaatgaaaacttaaaaaaagctatgcaaaagtaa

DBGET integrated database retrieval system