KEGG   Pyrococcus furiosus COM1: PFC_00810Help
Entry
PFC_00810         CDS       T02183                                 

Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00030  Pentose phosphate pathway
pfi01100  Metabolic pathways
pfi01120  Microbial metabolism in diverse environments
pfi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PFC_00810
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PFC_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AFN03135
UniProt: I6UX53
LinkDB All DBs
Structure
PDB: 

Position
complement(159142..160959)
Genome map
AA seq 605 aa AA seqDB search
MYGNWGRFIRVNLSTGDIKVEEYDEELAKKWLGSRGLAIYLLLKEMDPTVDPLSPENKLI
IAAGPLTGTSAPTGGRYNVVTKSPLTGFITMANSGGYFGAELKFAGYDAIVVEGKAEKPV
YIYIKDEHIEIRDASHIWGKKVSETEATIRKEVGSEKVKIASIGPAGENLVKFAAIMNDG
HRAAGRGGVGAVMGSKNLKAIAVEGSKTVPIADKQKFMLVVREKVNKLRNDPVAGGGLPK
YGTAVLVNIINENGLYPVKNFQTGVYPYAYEQSGEAMAAKYLVRNKPCYACPIGCGRVNR
LPTVGETEGPEYESVWALGANLGINDLASIIEANHMCDELGLDTISTGGTLATAMELYEK
GHIKDEELGDAPPFRWGNTEVLHYYIEKIAKREGFGDKLAEGSYRLAESYGHPELSMTVK
KLELPAYDPRGAEGHGLGYATNNRGGCHIKNYMISPEILGYPYKMDPHDVSDDKIKMLIL
FQDLTALIDSAGLCLFTTFGLGADDYRDLLNAALGWDFTTEDYLKIGERIWNAERLFNLK
AGLDPARDDTLPKRFLEEPMPEGPNKGHTVRLKEMLPRYYKLRGWTEDGKIPKEKLEELG
IAEFY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggcaactggggtagatttatacgtgtaaacctttctaccggagatattaaggta
gaagaatacgacgaagaattggctaagaagtggcttggaagtagaggtttggccatatac
cttcttctaaaggaaatggatccaactgtagatcccttaagccccgaaaacaagcttatc
atcgccgctggtcctctaactggaacaagcgcaccaaccggtggaaggtacaatgtcgta
acaaagagtcccctaactggattcataactatggcaaattccggtgggtactttggagct
gagctgaagtttgcaggttacgacgccattgttgttgagggtaaggcggagaagcccgtt
tatatttacatcaaagacgagcacattgagattagagatgcttcccacatatggggcaag
aaggttagcgagactgaagccacaataaggaaggaagttggaagcgagaaagtaaagata
gcatccatcggccctgccggtgagaatttggtcaagttcgcggcaataatgaatgatgga
cacagagcggctggaagaggtggagtgggagctgtaatgggaagcaaaaaccttaaggca
atagcagttgagggaagcaaaaccgtcccaatagctgacaagcagaagttcatgcttgtt
gttagagaaaaggtaaacaagcttaggaatgaccccgttgctggaggaggacttccaaag
tacggaacagctgttctagtgaatataattaacgaaaacgggctatatccagtcaagaac
ttccagactggtgtttatccatatgcctacgagcaaagcggtgaagcaatggctgccaag
tatctagttagaaataagccatgttacgcttgtccaattggatgtggtagagtaaataga
ttaccaacagttggagagacagaaggtccagaatacgagagcgtttgggccctgggagct
aatctgggaattaacgatctcgcatcaataatagaggcaaaccacatgtgtgacgagctt
ggacttgatacaatatcaactggtggaactctggccactgcaatggaactttatgaaaaa
ggccacataaaggatgaagagctcggagatgctccacccttcaggtggggcaacaccgag
gttctccactactacatagaaaagatagcaaagagggaaggctttggtgataagctcgct
gagggaagctatagactggctgagagctatggacacccagaactttccatgaccgttaag
aagttggagctaccagcttatgacccaaggggagcagaggggcatggtttaggttatgca
acaaacaaccgtggtggatgtcacattaagaactacatgattagccctgagatcctcgga
tacccatacaagatggatccacatgatgttagtgacgataagatcaagatgttaatccta
ttccaagacctcacggcattgatagactcagcaggcctatgtctcttcacaacattcggc
cttggagctgacgattaccgtgacctcctcaatgccgctctaggatgggacttcacaacc
gaagactacctcaagataggagagaggatatggaatgctgaaagactgttcaaccttaag
gcaggcctagacccagcaagagatgacactctaccaaagaggttcctcgaggagccaatg
ccagaaggtccaaacaagggacacacagttagacttaaagagatgttgccaagatactac
aagcttagaggatggactgaagacgggaagattccaaaagagaagcttgaggagcttgga
atcgctgagttctattga

DBGET integrated database retrieval system