KEGG   Pyrococcus furiosus COM1: PFC_01500Help
Entry
PFC_01500         CDS       T02183                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00500  Starch and sucrose metabolism
pfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFC_01500
Enzymes [BR:pfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PFC_01500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AFN03271
UniProt: I6UND2
LinkDB All DBs
Position
293779..295161
Genome map
AA seq 460 aa AA seqDB search
MNIKKLTPLLTLLLFFIVLASPVSAAKYLELEEGGVIMQAFYWDVPGGGIWWDHIRSKIP
EWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKEELVRLIQT
AHAYGIKVIADVVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNELHCCD
EGTFGGFPDICHHKEWDQYWLWKSNESYAAYLRSIGFDGWRFDYVKGYGAWVVRDWLNWW
GGWAVGEYWDTNVDALLSWAYESGAKVFDFPLYYKMDEAFDNNNIPALVYALQNGQTVVS
RDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDFEEWLNKDKLINLIWIHDH
LAGGSTTIVYYDNDELIFVRNGDSRRPGLITYINLSPNWVGRWVYVPKFAGACIHEYTGN
LGGWVDKRVDSSGWVYLEAPPHDPANGYYGYSVWSYCGVG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaacataaagaaattaacacccctcctaactctattactgttttttatagtactagca
agtccagtaagtgcagcaaaatacttggagcttgaagagggaggagttataatgcaagca
ttctattgggatgttccagggggaggaatttggtgggatcatataagatcgaagattcct
gaatggtatgaagctggaatctctgcaatatggctacctccaccaagcaaggggatgagt
ggaggatattcaatgggctacgatccctatgattactttgatctcggcgagtactaccag
aagggaactgtagagacgcgttttggatcaaaagaagaactagtgagattgatacaaact
gcccatgcctatggaataaaggtaatcgccgatgtagttataaaccacagggctggtggt
gacctagaatggaaccccttcgttggagattacacatggacagacttttctaaagttgcc
tcagggaaatatacagctaactatctggacttccatccaaacgagcttcattgttgtgac
gaaggaacctttggaggatttccagatatatgtcatcacaaagagtgggatcagtactgg
ctatggaagagcaatgagagttatgctgcttatttaagaagcataggatttgatggttgg
agatttgactatgttaagggctatggagcttgggttgtcagagactggcttaattggtgg
ggaggttgggcagttggagagtactgggacacaaatgtagatgcactactaagctgggca
tatgagagtggtgcaaaggtctttgacttcccgctctactataaaatggatgaagcattt
gacaataacaacattccagcattagtctatgccctacaaaacggacaaactgtagtttcg
agagatccatttaaggcagtaactttcgttgccaatcatgacacagatataatatggaac
aagtatccagcatatgcgttcatattgacatatgagggacagccagtaatattctacagg
gactttgaggaatggctgaacaaggataagctaattaacctcatttggatccatgatcat
ttggcaggaggaagcacaacaattgtctactacgacaacgatgagctcatatttgtgaga
aatggagattctagaaggcctgggcttataacttacattaacttgagccctaactgggtt
ggtaggtgggtatacgttccaaagtttgcaggggcttgtattcatgaatacactggaaac
ctaggaggatgggtagataaaagagtagatagtagcggatgggtatacctagaggcacca
cctcacgatccagctaacggctactatgggtactccgtatggagttattgtggtgttggg
tga

DBGET integrated database retrieval system