KEGG   Pyrococcus furiosus COM1: PFC_04060Help
Entry
PFC_04060         CDS       T02183                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00010  Glycolysis / Gluconeogenesis
pfi00020  Citrate cycle (TCA cycle)
pfi00620  Pyruvate metabolism
pfi00640  Propanoate metabolism
pfi00650  Butanoate metabolism
pfi00680  Methane metabolism
pfi00720  Carbon fixation pathways in prokaryotes
pfi01100  Metabolic pathways
pfi01110  Biosynthesis of secondary metabolites
pfi01120  Microbial metabolism in diverse environments
pfi01130  Biosynthesis of antibiotics
pfi01200  Carbon metabolism
Module
pfi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFC_04060 (porA)
   00020 Citrate cycle (TCA cycle)
    PFC_04060 (porA)
   00620 Pyruvate metabolism
    PFC_04060 (porA)
   00640 Propanoate metabolism
    PFC_04060 (porA)
   00650 Butanoate metabolism
    PFC_04060 (porA)
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PFC_04060 (porA)
   00680 Methane metabolism
    PFC_04060 (porA)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    PFC_04060 (porA)
Enzymes [BR:pfi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     PFC_04060 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DUF4290 PRA-PH
Motif
Other DBs
NCBI-ProteinID: AFN03761
UniProt: I6UPL5
LinkDB All DBs
Position
complement(728478..729668)
Genome map
AA seq 396 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLIPEKISEFVANGELDAEFIKVESEH
SAISACVGAAAAGVRTFTATASQGLALMHEILFIAAGMRLPIVMAIGNRALSAPINIWND
WQDTISQRDTGWMQFYAENNQEALDLILIAYKVAEDERVLLPAMVGFDAFILTHTVEPVE
IPDQEVVDEFLGEYEPKHAYIDPARPITQGSLAFPAHYMESRYTVWEAMERAKKVIDEAF
AEFEKKFGRKYQKIEEYKTEDADIIFVTMGSLAGTLKEWIDKKREEGYKVGAAKITVYRP
FPVEEIRELAKKAKVLAFLEKNITIGLYGAVFTDASAALINESEKPLMVDFIVGLGGRDV
TFNQLDEALEIAEKALKEGKVENPINWIGLRWELVK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaggaaagttatgaaggctaatgaagccgctgcttgggctgctaagttggct
aaaccaaaggttatagcagcattcccaattacaccttcaaccctaatacccgagaagatt
agtgaattcgtggcaaatggtgaactagacgcagagtttattaaagttgaaagtgagcac
tcagcaatttcagcatgtgtaggtgcggctgctgcaggtgttagaaccttcacagcaaca
gcctctcaaggtttggctttaatgcacgaaattctattcattgctgctggcatgagattg
ccaattgtaatggcaattggtaacagagctttgtcagctccaattaacatctggaatgac
tggcaagacacaattagccaaagagatactggatggatgcagttctatgcagaaaacaac
caagaggctctagacttgatcctaatagcttacaaagttgcagaagatgaaagagtcctc
cttccagccatggttggattcgatgcattcatcctaacccatacagttgaaccagtagaa
atcccagaccaagaggttgttgatgaattcctaggagaatacgagcccaagcacgcatat
attgatcccgcaaggcctataactcaaggaagccttgcattcccggcccactatatggag
agcagatacacagtttgggaggctatggagagagcaaagaaggtaatagacgaagcattt
gcagaattcgagaagaagttcggaagaaagtaccagaagattgaggagtacaagacagag
gatgcagacataatcttcgtaacaatgggttcactggctggaacccttaaagagtggata
gacaagaagagagaggaaggttacaaagtcggtgcagcaaagataaccgtttataggcca
ttcccagtagaagagataagagaactagcaaagaaggcaaaggttctcgcattcctagag
aagaacatcacaatcggcctttatggtgcagtctttacggatgcatcagcagctctcatc
aacgagagcgaaaagccactaatggtcgacttcatagttggcctaggtggaagagatgta
accttcaaccagcttgacgaagccctggaaattgcagagaaggcactcaaggaaggtaaa
gttgagaatccaattaactggattggattaagatgggaacttgtgaagtga

DBGET integrated database retrieval system