KEGG   Pyrococcus furiosus COM1: PFC_05005Help
Entry
PFC_05005         CDS       T02183                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00630  Glyoxylate and dicarboxylate metabolism
pfi01100  Metabolic pathways
pfi01120  Microbial metabolism in diverse environments
pfi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PFC_05005 (rbcL)
Enzymes [BR:pfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PFC_05005 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFN03948
UniProt: I6V1K5
LinkDB All DBs
Position
complement(907099..908361)
Genome map
AA seq 420 aa AA seqDB search
MKVEWYLDFVDLDYTPGRDELIVEYYFEPNGVSPEEAAGRIASESSIGTWTTLWKMPEMA
KRSMAKVFYLEKSGEGYIAKIAYPLTLFEEGSIVQLLSAIAGNIFGMKALKNLRLLDFHP
PYEYLRHFKGPQYGVKGIREFMGVKERPLTATVPKPKMGWSVDEYAEIAYELWSGGIDLL
KDDENFTSFPFNRFEERVKKLYRIRDIVEAETEERKEYLINITGSVDVMEKRAELVANEG
GQYVMIDIIVTGWSALQYMREVTEDLGLAIHAHRAMHAAFTRNPKHGITMYAIAKLARMI
GVDQIHTGTAVGKMAGDYEEVKRINDFLLSKWEHIREVFPVASGGLHPGLMPELIRLFGK
DLVIQAGGGVMGHPDGPRAGAKALRDAIDAALEGVDLEEKAKSSPELKKALDKWGYLKPK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgagtggtatttagacttcgttgacttggactacactccaggtagagatgag
ttaattgtggagtattactttgaaccaaacggggtttctccagaagaagcagccggaagg
atagctagtgaaagctctataggaacgtggacaactctctggaaaatgcccgaaatggct
aagaggagtatggctaaggtattttatctagaaaaaagtggggagggatatattgctaag
attgcatacccattaacgcttttcgaagaaggaagcatagttcaacttttgagtgcgata
gctgggaacatcttcggaatgaaagcgttaaagaatttgaggcttctggacttccatccc
ccttatgagtatctgagacatttcaaagggccacagtatggtgtaaagggaattagagaa
ttcatgggggttaaagagagacctttgactgctaccgttccgaagcctaagatgggatgg
agtgttgatgaatacgcggagatagcatatgaactctggagtggagggatcgatctgtta
aaagacgatgaaaacttcactagctttccattcaacagatttgaagagagagtgaaaaaa
ttatataggattagggatatcgtggaggctgaaactgaggaaagaaaagagtacctaatc
aacattactggatccgttgatgttatggagaaaagagccgaactagtggcgaatgaggga
gggcagtacgttatgatagacataatagtcactggatggagcgcactccagtacatgaga
gaggtaactgaggatcttggattggctatacatgcccacagagccatgcatgccgcgttc
actagaaatcccaagcacgggataacgatgtatgcaatagccaagcttgccagaatgatt
ggcgttgatcaaattcacacggggactgcagttggaaagatggcaggtgattatgaggag
gttaaaaggataaacgacttcctacttagtaaatgggagcacataagagaagttttccca
gtagcaagtgggggacttcaccctggattgatgccagagcttatacgtctcttcgggaaa
gatctcgttattcaagcgggtggaggagttatggggcacccagatgggcccagggctgga
gctaaagccttgagagatgcaatagatgcggctttagaaggggttgatttagaggagaag
gcaaagtcgagtccagagctgaaaaaggcattagacaagtggggctacctaaagcctaaa
tga

DBGET integrated database retrieval system