KEGG   Pyrococcus furiosus COM1: PFC_08705Help
Entry
PFC_08705         CDS       T02183                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfi  Pyrococcus furiosus COM1
Pathway
pfi00620  Pyruvate metabolism
pfi00680  Methane metabolism
pfi00720  Carbon fixation pathways in prokaryotes
pfi01100  Metabolic pathways
pfi01120  Microbial metabolism in diverse environments
pfi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PFC_08705
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PFC_08705
   00680 Methane metabolism
    PFC_08705
Enzymes [BR:pfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PFC_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: AFN04666
UniProt: I6URR3
LinkDB All DBs
Position
complement(1576642..1578060)
Genome map
AA seq 472 aa AA seqDB search
MIPRIMSTQHPDNYSIPFFASSPILEGEDEITEAFYAFSVLGADEQMWDFEGKEVDEFVV
KKLLERYPTFFKNNILGKDIRLTPRVPNPSVEKEEAKLLLETLQGIARSADYARIFYGDN
IAPIFEVILPMTTSVEEIERVYWLYKKAVVWISREKIYDITVREWIGDFFPEKINVIPLF
ETKSALIKAAKITEAYILNRKNDIEYQRVFFARSDPAMNYGLITAVTYVKRALYEVLKVE
EELSIPIYPIIGVGGPPLRGGMRPDNVDAVVKEYPSVQTFTIQSSFKYDYPTKDVVKAVE
KIKSTKRKLPIPVEIPPFLVNYEAEYQKQIRILAPYINSVAKRIPRRRKRKLHIGLFGYS
RNVNGITLPRAITFTAALYSIGIPPELLALNSLTDSQLETISEYYINVYEDLEFAMRFFS
PKVAEKVGLKELAERVKEFKPEQIPEYIEEAEIVFKGEGDVMKLAQLRGFLG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaataatgagtactcaacatcctgacaactattcaataccatttttcgct
agctcccccatactagagggagaagatgagataacggaggcattctatgccttcagtgtc
cttggagcagatgaacaaatgtgggactttgaaggaaaagaagttgatgaattcgttgtt
aaaaaacttctcgagagatacccaacatttttcaagaacaatattcttggaaaggatatt
cgcctgaccccaagagttccaaacccaagtgtagaaaaagaagaagcaaagttacttctc
gaaacccttcaaggaatcgcaagaagtgcggattatgcaaggatattctatggagataac
atagctccaatattcgaagtaatacttcccatgacaactagtgtagaggaaattgagaga
gtatactggctctataagaaggcagtagtttggataagcagagagaaaatctatgatata
acagtaagggagtggatcggagatttcttcccagaaaaaattaatgtaatcccactgttt
gagacgaaatccgctctaatcaaagctgcaaaaataacagaagcttacatactaaatagg
aagaatgacattgagtatcagagggtcttttttgctagaagtgatcccgcaatgaactac
ggtctaattacagcagtcacttacgttaaaagggcactatatgaagttctaaaggtagaa
gaggagctcagcattccaatatacccaattatcggagttggtggtcctcccttgagagga
ggaatgagaccagataacgttgatgcagtagtaaaggaatatccaagtgtccaaaccttc
acaatccagagctccttcaagtatgactacccaaccaaagacgtcgttaaggcggtagag
aaaattaaatcgacaaaaagaaagttgccaattccagttgaaattcctccatttctggtt
aactatgaggcagaataccaaaagcagattagaattctagccccatacataaacagcgta
gcaaagagaatacccaggagaagaaagaggaagctccacataggattattcggatattca
agaaatgtgaacgggataactctgcccagagcaatcacattcactgctgccctttactcc
atcggaatccccccagaacttcttgcattaaactcactcacagactcccaactcgaaaca
atttcagaatactacatcaacgtatatgaagacttagaatttgccatgagatttttctct
ccaaaagttgctgaaaaggtaggattgaaagagctagcagaaagggtcaaggaattcaaa
ccagagcaaatccctgagtacattgaggaggcagaaatagtgtttaaaggggaaggagat
gtgatgaagctggcccagttaagagggtttcttggataa

DBGET integrated database retrieval system