KEGG   Pandoraea fibrosis: PI93_022860Help
Entry
PI93_022860       CDS       T06385                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfib  Pandoraea fibrosis
Brite
KEGG Orthology (KO) [BR:pfib00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PI93_022860 (ahpF)
Enzymes [BR:pfib01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PI93_022860 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin Thi4 K_oxygenase NAD_binding_8 FAD_binding_3 DUF2190 FMO-like
Motif
Other DBs
NCBI-ProteinID: QHF15175
LinkDB All DBs
Position
complement(5173735..5175333)
Genome map
AA seq 532 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKAAEMKALVDEIAPLSPQIAVVVRNDRDQ
DAGERRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTIAQIRALD
GDFRFETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQSEVEARQVMAVPTVFL
NGESFTQGRTSVKELLAKLDTGASARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGI
VTGVVAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVKTYDVDVIDTQRAEALIPG
KIHEVHLASGAVLKARAIVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFRGKRVAV
VGGGNSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVRVLMNAQTTEIHGD
GQKVNGLAYRDRESGETGAIALEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDAKGKTSL
PGVFAAGDVTTVPFKQIVIAVGDGAKASLGAFEHLMLSSVEDEATTPEKIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtacctccagaaagtcacgcgcccg
atcgagatcgctgtttggctcgacgacagtcccaaggcggccgagatgaaggcgctggtg
gacgagatcgcgccgctctcgccgcagattgcagttgtggtgcgcaacgacagggatcag
gacgcaggcgagcgtcgtccgtcttttgccatcggtacgccgggcgaggcaccgcggatt
cgtttcgccggtctgcccatggggcacgagttcacgtcactggtgcttgcgctgctgcaa
gtcggcggccatccggtcaaactcgacgacgacaccatcgcgcagatccgtgcgctggac
ggtgatttccgcttcgagacgtacatttcgctgtcgtgccagaactgcccggaagtcgtg
caggcgctcaacgtcatggcgctcatcaatccgcgcattcagcaggtcaccatcgacggc
gcgctgttccagagtgaagtcgaagcgcgtcaggtgatggccgtgccgacggtgttcctc
aacggcgagtccttcacgcaaggccgtaccagcgtgaaggagttgcttgcgaagctcgac
acgggagcgagcgcacgggccgcgaaggcgctcgaaaacaagccggtctacgacatgctg
atcgtgggcggtggcccggcaggcgccgccgctgccatctacgccgctcgcaaggggatc
gtgacgggcgtggtcgccgagcgtttcggcggtcaggtgctcgacacgatggccatcgag
aatttcgtctcggtgacgcacaccgaagggccgaagttcgccaccgcgctggagcaacac
gtcaagacgtatgacgtcgacgtgatcgacacgcaacgcgccgaagccttgatcccgggc
aagattcacgaagtgcatctggcaagcggcgccgtactgaaagcacgtgccatcgtgctt
gctaccggtgcgcgttggcgcgaaatcggcgtgccgggagaacgcgaataccgcaaccgt
ggcgtggcttactgcccgcactgcgatggcccgctcttcaggggcaagcgcgtcgcggtc
gttggcggtggcaactctggcgtggaagcggccatcgatctggcgggcatcgtcaaggaa
gtcacgctgatcgaatatggtgcgcaactccgtgcagacgaagtgttgcagcgcaagctg
cgcagtctgccgaatgtgcgcgtgctgatgaacgcgcaaacgaccgaaattcacggtgac
ggtcagaaggtcaacggccttgcctatcgcgaccgtgaatccggcgagaccggcgcgatc
gcgctcgaaggggtgttcgtgcagatcggtctggtccccaacaccgaatggctcaagggc
acggtggccctctcgcgtcacggcgagatcgaagtcgatgccaagggcaagacgtcgctg
cccggcgtgttcgcggcgggtgacgtcacgacggtgccgttcaagcagatcgtgatcgcg
gtaggcgacggcgcaaaggcctcgctgggtgcttttgaacacctgatgctcagctcggtg
gaagacgaagcgacgacaccggagaagatcgctgcctga

DBGET integrated database retrieval system