KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_145126Help
Entry
MYCFIDRAFT_145126 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYCFIDRAFT_145126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pfj02000]
    MYCFIDRAFT_145126
Enzymes [BR:pfj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYCFIDRAFT_145126
Transporters [BR:pfj02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYCFIDRAFT_145126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 19331300
NCBI-ProteinID: XP_007931550
JGI: 145126
UniProt: M2ZF94
LinkDB All DBs
Position
Unknown
AA seq 265 aa AA seqDB search
MASHPDADLHPVATGPAKSIVDAHQKEEPLKLYSGWFCPFVQRVWSIFEEKKIPYQYIEN
KSQSLLSLNPRGLVPTLQFSDKPLFESTVICEFLEDAYPESTPKFLPEDVYLRAKTRLWI
EFFSRSLVPAFHRFLQVTRVSNFEDKQLESETIDKDLSKEDEDLSSNEEGEEPTLIDFAV
APWIVRLWGSDQFKGGLGIPGEGKGGRDEVVWERLRRWKMALENRPSIRDTTSEREYYLP
IYQRYAEDRAQSELAKSIRKGQGVV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccatccagacgccgaccttcaccccgtcgccacaggcccggcaaaatccatc
gtcgacgcccaccagaaagaagaacccttgaaactctactcaggctggttctgccctttc
gtccaaagagtctggtccattttcgaagaaaagaaaatcccataccaatacatcgaaaac
aaatcgcaatccctcctctccctcaaccctcgcgggctcgtgcccaccctccaattctct
gacaaacccctcttcgaatctaccgtcatttgcgaatttttggaggatgcctacccggaa
tccacgccgaaattcttgcctgaagatgtgtatttgcgagcgaagactaggctttggatt
gagttcttttcgaggagccttgttccggcttttcatcgatttttgcaggtaactagggtt
agcaacttcgaagataagcagttagaatcggagactatagataaagaccttagcaaagaa
gacgaagatcttagtagtaacgaggaaggggaggagccgacgttgattgattttgcggtt
gcgccttggattgtgaggttgtggggttccgatcagttcaaggggggtttggggattcct
ggggagggaaaggggggtagggatgaggttgtttgggagaggttgaggaggtggaagatg
gcgctggagaataggccgagtattcgtgatacgacgtcggagagggagtattatttgcct
atttatcagaggtatgctgaggatcgtgcgcagagtgagctggcgaagagtattcggaag
ggtcaaggtgttgtgtag

DBGET integrated database retrieval system