KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_148879Help
Entry
MYCFIDRAFT_148879 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
Organism
pfj  Pseudocercospora fijiensis
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc TrkA_N Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 19331422
NCBI-ProteinID: XP_007921363
JGI: 148879
UniProt: N1QB21
LinkDB All DBs
Position
Unknown
AA seq 385 aa AA seqDB search
MAHETIQDSNLPHSKENQPTSESVKSMKAVRFHGKEDLRFEDIPEPVCGPGQVKVKPAYQ
IANSCPDLHEYLGGPSLCPESKPHPITGETVPLTFGHEFSGVIEEVGEGVSDRFKVGGRV
VVAPIIYDGDCGACQDGLVNCCWKNGFVGLSGWGGGLSEHLVVPEYTLYNCPDNVGLDVA
ALVEPLAVGWHAVNSSPFKRTDTALILGGGPIGLSVVQALRARGCPQIIVSEVSGMRKQF
AKDLGAHVVLDPTKDDIVAECLKLTNNRGVDVTFDAAGVQPGLDQAVNSLKARGTHVNIA
IWEKRCTLWPNDLVFKERRYLGVATYVKSDFQEVIDAISDGRLDMCKKMITKRIEMRDVV
EEGFKTLINDKDRQVKILVKGSGEI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcccacgaaactatccaggacagcaacctgccacattcgaaagaaaaccagcccaca
tcggagagtgtaaagtcgatgaaggcggtgcgctttcatggtaaagaggatttgcggttt
gaagatattccagagccggtttgtggacctggtcaggtaaaggtcaaaccggcctaccaa
atagctaacagttgtcctgaccttcacgaatacctcggcgggccctcgttgtgtccagaa
agcaaaccacatccgattaccggggagacagtaccgcttacgttcgggcacgagttcagt
ggagtgattgaagaggttggagaaggtgtttccgaccgattcaaggttggcggccgagtt
gtagtggcgcccattatctacgacggcgactgtggcgcatgtcaagacgggcttgtcaat
tgctgttggaagaacggctttgtcggcctgagcggttgggggggaggcctttcagagcat
ttggtggttccggagtatacactttacaactgcccggacaatgtcggcctagacgtggca
gcgctcgtagagccactcgcagttggctggcatgctgtgaattcgagtcccttcaagcga
acagatacagccttgatccttgggggaggtccgatcgggttatccgtcgttcaagcctta
cgcgctcgcggatgtccacagatcattgtgtctgaagtgtccggaatgcgaaagcagttt
gcaaaagatctcggcgcccacgtggttctagacccgaccaaggatgatatcgttgccgaa
tgtctcaagttgacaaataatcgtggcgtcgacgttactttcgatgcggctggtgtgcaa
ccaggtctcgaccaagccgtgaactcgctcaaggcccgcggcacccacgtcaatatcgcg
atctgggagaaaagatgtacactttggccaaatgaccttgtcttcaaggagcgaagatac
ctcggagtcgcaacatatgttaagagtgacttccaggaggtcatagatgccatttcggat
gggcggcttgacatgtgtaagaaaatgattaccaagagaatagaaatgagagacgtggtc
gaggaaggctttaagacattgatcaatgataaagaccgacaagtaaagatattagtgaag
gggagtggtgaaatctaa

DBGET integrated database retrieval system