KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_181759Help
Entry
MYCFIDRAFT_181759 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00250  Alanine, aspartate and glutamate metabolism
pfj00280  Valine, leucine and isoleucine degradation
pfj00410  beta-Alanine metabolism
pfj00640  Propanoate metabolism
pfj00650  Butanoate metabolism
pfj01100  Metabolic pathways
Module
pfj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MYCFIDRAFT_181759
   00650 Butanoate metabolism
    MYCFIDRAFT_181759
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCFIDRAFT_181759
   00280 Valine, leucine and isoleucine degradation
    MYCFIDRAFT_181759
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCFIDRAFT_181759
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfj01007]
    MYCFIDRAFT_181759
Enzymes [BR:pfj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MYCFIDRAFT_181759
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MYCFIDRAFT_181759
Amino acid related enzymes [BR:pfj01007]
 Aminotransferase (transaminase)
  Class III
   MYCFIDRAFT_181759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 19334569
NCBI-ProteinID: XP_007923218
JGI: 181759
UniProt: M3B8S4
LinkDB All DBs
Position
Unknown
AA seq 488 aa AA seqDB search
MASQSPTHSASASAAAAVKSAFKDQSYLPDEPTGPSIKTEIPGPKSKEAIAELDKVFDTR
SLNMMVNYQNSFGNYIADVDGNVLLDVYAQIASIPVGYSNPALLAAATSPEMASAIINRP
ALGNFPQHDWAHILKSGILRVAPPGCDQVFTAQAGSDANELAYKAAFMWKRRQQRGGPHV
EFTPEEINSSMNNQSPGSPNMSILSFKTGFHGRLFASLSTTRSKPIHKLDIPAFDWPQAP
FPALKYPLEQHAEENAKEEARCLAEAEELITTYHIPPAAIIIEPIQSEGGDNHASPAFFN
GLRQITRKHNVLMIVDEVQTGVGATGKFWAHEHWNLQDPPDMVTFSKKAQTAGYYFGNND
LRPNKPYRQFNTWMGDPARAILFRAIIDEIERLNLVQNTAETGDYLFAGLENLAKKYPAE
IQNLRGKGQGTFIAWDSPRRDEVLKKAKGVGINIGGSGERAVRLRPMLIFQKKHADILLG
GLEKIFQP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcaatcacccacacacagcgccagcgccagcgctgcagctgctgtcaagtct
gcattcaaggaccagtcgtaccttccagatgagccgaccggcccaagcatcaaaacagaa
attccgggcccaaagtcgaaagaggcgatcgcggaactcgataaggtgttcgatactcga
tcgctgaacatgatggtgaactaccagaacagcttcggcaactatatcgcagacgtcgat
ggaaacgtcctgctcgacgtctatgctcaaattgcttccatcccagtgggatacagcaac
cccgccttgctcgccgccgctacaagtccggagatggcctcggccattatcaacagacca
gcattgggcaacttcccacaacatgattgggctcacatcctcaagtctggcattcttcgt
gtcgcgccaccaggttgcgaccaagtcttcacagctcaggccggatctgatgccaatgag
cttgcttacaaggctgctttcatgtggaagcgtcgccagcagcgcggtggtccacatgtc
gagttcacgcccgaggagataaactcctccatgaacaaccaatctccaggttctccgaac
atgtccattctatccttcaagactggttttcacggccgtctcttcgcttctctctccacc
actcgctccaagccaattcacaagctcgacattccagcatttgactggccacaagctccg
ttcccagctctcaagtacccactcgagcaacacgccgaggagaacgccaaggaggaggca
cgctgtctcgctgaggccgaggagctcatcaccacctaccacatacctccggccgcaatc
atcatcgagccgattcagtctgagggtggcgacaaccatgccagcccagcattcttcaac
ggcctgcgacagattacgagaaaacacaatgtcctcatgattgtcgacgaagtccagacg
ggtgtgggtgcgactggcaagttctgggctcacgagcactggaatctgcaagacccaccg
gacatggtcacattctcaaagaaggcacagactgccggatactacttcggcaacaacgac
ttgcgaccaaacaagccataccgccaattcaacacctggatgggtgacccagctcgcgcc
atccttttccgtgctatcatcgatgagattgagcgtctgaatctcgtccaaaacactgcc
gagactggcgactacctcttcgctggtcttgagaaccttgccaagaaatacccagcagag
atacaaaacctccgtggcaagggccaaggcacattcattgcctgggactcgccacgccgt
gatgaggttcttaagaaggctaagggtgttggtatcaacatcggtggctctggagagcgc
gcggtgcgactaaggcctatgctgatcttccagaaaaagcatgctgacatcctgctgggc
ggtcttgagaagatctttcagccgtaa

DBGET integrated database retrieval system