KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_190373Help
Entry
MYCFIDRAFT_190373 CDS       T03109                                 

Definition
(RefSeq) glycoside hydrolase family 15 carbohydrate-binding module family 20 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00500  Starch and sucrose metabolism
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_190373
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MYCFIDRAFT_190373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19335145
NCBI-ProteinID: XP_007930191
JGI: 190373
UniProt: M2YP05
LinkDB All DBs
Position
Unknown
AA seq 572 aa AA seqDB search
MNTHRMGKQDGTALQLPEALGPRATGTLESWLAAEGPIALQGILNNIGSSGSKVSGASAG
IIVASPSKSNPDYFYTWTRDAALTIKCLIDQFLSGGPSSLETTIQDYINAQVHLQTVNNP
SGGLCSGGLGEPKFNVDGTPFTGSWGRPQRDGPALRATALIAYARYLLGKGDTANVTNII
WPVVQNDLSYVSQYWNQTGFDLWEEVNSSSFFTTAAQYRALIEGSALAAQIGKQCQGCDS
QAPQVLCFLQSFWTGSYVLSNTGGGRSGKDANPVLASIHLFDSSTGCNSNTFQPCSDKAL
ANHKQVTDSFRSIYSINSGIAAGKGVAVGRYQEDSYQGGNPWYLNTFAAAEQLYDAVYQW
KKAGSITITATSLPFFKDVYVAATTGTFSSSTSTFNSIITAVGVYADSYMSKAQQYTPQG
GALAEQYSRSNGSPLSAGDLTWSYSAFLTAFNARKAAMPASWASCSATPTLTNVLFEETA
TTTYGENVFISGSISQLGNWSPDNAVALSAKNYTSTNNLWFVTVQLPVGQSFMYKYLRKE
TDGSVRWESDPNRSYTVPKNCAGSATQSDTWR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacaccgaatgggcaagcaagacgggacggcgctgcagcttcctgaggcactg
ggaccacgagccacggggaccctcgagtcctggctggctgctgagggccccatcgcacta
caaggtattctcaacaatataggatcctctggttcgaaagtctcaggtgccagcgccggc
attattgtagcttctccatcgaagagcaatcccgattacttctatacttggacacgcgat
gcggcattgacgatcaaatgtctgatcgaccaattcctttctggaggaccatcgagcttg
gagaccaccatccaggactacatcaatgcccaagtgcatcttcagactgtcaataaccca
tcaggcggcttgtgctctggcggtctcggggagccaaagttcaatgtagatggcacgcca
ttcactggctcctggggcagacctcaacgcgatggccctgctctgcgtgcaacagcgttg
atcgcctatgcccgatatttgctcggcaaaggcgatacagctaatgtcacgaacatcatc
tggcccgttgttcagaacgacttgagctatgtcagccagtattggaaccagactgggttc
gatctttgggaagaagtcaacagctcttcattcttcacgaccgcagcgcagtatcgtgct
ttaattgagggcagcgcgctggctgctcagattggcaaacaatgccaaggctgtgactct
caggcgccgcaagtactgtgcttcttgcaaagcttttggacaggctcgtatgtgctatca
aatactggtggtggtcgctcgggcaaagacgcgaatccagtcctggcttctatccacctc
ttcgactcatcgacgggatgcaactccaacacgttccaaccatgtagcgataaggctttg
gccaatcacaaacaagtcacagactcgtttaggtccatatactcgatcaacagcggaatc
gccgctggaaaaggcgtcgccgtaggaaggtaccaagaggactcctatcaaggcggaaac
ccatggtacttgaatacatttgctgcagctgagcagctttacgatgccgtgtatcagtgg
aagaaagcaggatctataactatcacagcaacctcgctaccatttttcaaggacgtttat
gtggcagctaccaccggcactttttcgtcttcgacctctacattcaactctatcattacc
gcagtaggggtctatgcggacagctacatgtccaaggctcaacaatacactccacaaggt
ggagcccttgcagagcagtactcccgctcaaacggcagcccgctctctgctggagaccta
acgtggtcatattccgccttcctgacagctttcaacgctcgcaaagcagctatgccagcc
tcttgggccagctgcagtgccactccgacgcttaccaatgtattattcgaagagacagca
acgacaacctatggcgagaatgtctttatttctggaagcatctctcagctcggcaactgg
agtccggacaacgctgtcgctcttagtgctaagaactataccagcaccaacaatctttgg
tttgtgactgtgcaattaccggtcggacaaagctttatgtacaagtacctcaggaaggag
acagacggcagcgtaaggtgggagagcgacccgaacaggtcgtatactgtgcctaagaat
tgtgccgggtcggcaacgcaaagcgatacgtggagatga

DBGET integrated database retrieval system