KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_205464Help
Entry
MYCFIDRAFT_205464 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MYCFIDRAFT_205464
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MYCFIDRAFT_205464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 19336389
NCBI-ProteinID: XP_007932080
JGI: 205464
UniProt: M3AJH7
LinkDB All DBs
Position
Unknown
AA seq 1438 aa AA seqDB search
MNMTTLLLLLLVIGSTLSWFVRYRFLNVYSRLPPEPQRKEPQIEIFPESQETDSKPGLAN
YFDEFLSAIKVFGYLERPVFHELTRTMQTRKLIAGETLLLEEEKGFCLVVDGLVQIFVKS
NRAQDMDCSGELAVADDDQVEDRTGSHGSYQLLTEVKNGAPMSSLFSILALFTENVKLRF
DEEDEHLTSSGSSGNLKQQLRMAPHLEDGVAASGTNSPIQWTGPGSSRPVSRQRAHSNAH
MHGVYAARDPPPLTLDGSGTDESQQQQHSRRPSFTQGKSTRQQRKSKQQASAHPDIVARA
TVDTTIAIIPASAFHRITRIYPKATAHIVQVILTRLQRVTLATANSYLGLTSEVLRTERL
MDRYTSYDLPDFLRGEALERLKDKFRKDQERIGLEEGMKGIALHNPRTAQHKRTSSSLQR
EAAVRARMSVGNGSLHSSTVDNGDRCGMSAGDLLTNIHAARSPNGRRSQPGSFSQPYVAP
KNSIGNLQSIESRKKDFYSPVIDPRPMMHRQESIDEDLMFRESIMECMAKAIGLTNSHTT
RRAESVAQSPRLVSYDSKKQSAVFNNAFGFMDPYDGSQEDGDSVASASAFSVGGSANIME
DLKTEVEIVYFPKDSVLVEEGERNPGIYYVIDGFLDVSASVEEQEAHSNVLGTMARPEGL
EIPEFATSAARRKSDNKRASSAGLSEHHRRKKSGYVRKSLFLIKPGGLAGYLGTISSYRS
LITITAKTDVYVGFLPRMAIERIVERHPVVLLTMAKRMTSLLPRLILHIDFALEWVQVNA
GQAIYHQKEESDAIYIVLNGRLRAIQESEDGDDMKVIGEYGQGDSVGELEVLTESSRPGS
LHAIRDTELAKFPKTLFNSLAQEHPGITIKVSKIIASRMRALIENPMNEAEHYNTLAMER
PKVASTTNLRTVAVIPCTVGVPVVEFGNKLHDALRQIGTPNGVSVLTQTSILNHLGRHAF
SRMGKLKLSQYLADLEEKYGIVIYVADTSVKSPWTQTCISQADCIYLVGLAEGTPAIGEY
ERFLLTTKTTARKELILLHSERYCPSGTTRAWLRNRPWINGGHHHVQMAFRTAPEPVHAH
PAGKRFGNAIKQRVQVLQAELHKYTSRRVRQTPLFSAETPFKGDFHRLARRLCGKTVGLV
LGGGGARGLAHVGIIRALEEAGLPIDIVGGTSIGALVGGVYAQDAEVVPMYGRVKKFAGR
MGSMWRFALDVTYPSASYTTGHEFNRGIFKIFGDSQIEDFWLSYYCNSTNISKSRPEIHT
SGYVWRYVRASMSLAGLLPPMCDDGHMLLDGGYTDNLTVSHMKALGADQIFAVDVGALDD
DTPQAYGDSLSGLWAAVNRWNPFSSHPNPPTLSEIQARLAYVSSVDNLARAKNIPGCRYM
RPPIETYGTLDFGKFDEIYQVGYEYGKKFLADLDVRGNAETDDKRNLRRTMAPRRASI
NT seq 4317 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgactaccctgctgctgctcctgctggtgatcggctccacgctcagctggttc
gtgagatacaggtttctcaatgtctactctcgcctgccaccagagccgcaacggaaggag
ccgcaaatagagatctttccagagtctcaagagaccgactcgaagccaggcttggccaat
tactttgatgaatttcttagcgcgatcaaggtttttggatatctggagcgaccagtcttc
cacgagcttactaggaccatgcagacccggaaactgatcgctggagagactctgctgctc
gaagaagaaaagggattttgcttggtcgtggacggcttagtgcagatctttgtcaagtcg
aatcgtgctcaagacatggattgctcgggcgagcttgcagtcgcagacgacgatcaggtc
gaagatcgcacaggctcgcacggcagctatcaactcttgaccgaagtcaaaaatggtgct
ccaatgtcgtccctcttttcaattttggcgctgttcacagagaacgtcaagctgagattt
gacgaagaagatgaacacctcacttcgagtgggtccagtggcaatttgaagcagcagctg
aggatggcgccacatctcgaggatggagttgcagcctctggtaccaacagccccatacaa
tggaccggtccgggctcgtcacgcccagtctcacgacaacgagcacattcgaatgcgcat
atgcacggcgtttacgcagcacgggaccctccgcctcttactctcgacggcagtggcaca
gatgagagtcagcaacaacagcatagcaggcggccaagtttcacacagggaaaaagcacc
agacagcagcgaaagtcgaagcagcaggcttcagctcatccagatatcgtggcacgagcg
accgtggacaccacgattgcaatcataccggccagcgcctttcacagaataacaaggata
tatcccaaggcgactgcacacatcgtacaagtcatcctgacgaggctgcagcgagtgacg
ctggcaactgcgaattcttaccttggtctcactagcgaagtgctgcgcacggaaaggctg
atggacaggtacacaagctatgatcttcctgacttcctgcgaggcgaggcactagaacgc
ttaaaggataagttccggaaagaccaggagcgaattgggcttgaagaaggcatgaaaggc
attgcactccacaacccacgtactgctcagcacaaacggactagcagtagtcttcagcgg
gaagccgctgtgcgagcgcggatgagcgtaggcaacggaagccttcattcgagcactgtc
gataatggtgacagatgtggcatgagtgcaggagatctgcttaccaacatccatgctgcg
aggtcaccaaatggtcgcagaagtcaaccaggcagcttttcgcagccttacgttgccccg
aagaactccattggcaaccttcagtcaattgaatcacgtaagaaggacttttacagtcca
gtcatagatccacgacccatgatgcatcggcaggaatccatagatgaagatctgatgttc
agagagtcaatcatggaatgcatggcaaaggctattggtctcacgaattctcataccact
cgtcgagctgaatctgtcgcgcagtctccgcgactggtttcatacgactcgaaaaagcaa
agtgccgtcttcaacaatgcttttggatttatggacccgtatgatggctctcaggaagac
ggcgactctgtcgcatcagcatctgcgttcagcgtcggtggttcggcaaacatcatggaa
gatctgaaaactgaagtcgagatagtctacttccccaaggactctgtgctagtcgaagaa
ggggagcgtaatcctgggatctactacgtgatagatggctttcttgacgttagcgcgtct
gtagaggagcaagaggcgcacagcaatgtgctaggaaccatggcgaggccagaagggttg
gagattccagagtttgcaacttcggccgcgcgaagaaaatcggacaacaaaagagcctca
tccgcgggtctctcagagcatcatagacgaaagaaatctggctatgtacgcaagagtctg
tttctcatcaaaccaggtggactggcaggatatctcggcacgatctcctcctaccgctca
ttaatcaccatcaccgccaagaccgatgtctatgtcggcttcttgcctcggatggcaatt
gaacgaatcgtggaaaggcatcccgttgttctactgaccatggcaaaacgcatgacaagt
ctgctaccacgtctaatccttcacattgactttgccctcgaatgggtgcaggtcaatgcc
ggccaggcaatataccatcaaaaagaggagagtgacgccatctacattgtgctcaacggt
cggctgcgggcaatccaagagagcgaggatggcgatgacatgaaagtcatcggggagtac
gggcagggtgacagtgtcggagagcttgaggtcttgacagagtcatctcgacctggctca
cttcacgccattcgcgatacagaacttgccaaatttcccaagacattgttcaacagtctc
gctcaagaacatccgggcatcacgatcaaggtgtccaagattattgcgtcgcgtatgcgg
gcattaatcgagaatccaatgaacgaagcagagcattacaacacactggccatggaacga
ccaaaggtggcgtcaacgacgaacctgagaacagtcgcagtgatcccatgcacggttgga
gtgcccgttgtggagtttggcaacaaattgcacgacgctttaaggcagattggcacgccg
aatggagtgtcagtgctcactcagacgagcattctcaatcatctggggaggcatgcgttc
agtaggatgggcaagctcaagctttcgcaatatctggcagacctcgaggagaagtacggc
atagtgatatacgtggcagacacgagtgtcaaatctccttggacacagacatgtatcagc
caagccgactgcatatatctggttgggctcgctgaggggactccagcgattggcgagtat
gagcgcttcttgctgactaccaagacgacggctcggaaagagcttatcctgctgcacagt
gagcgatattgcccttcaggcacgacgagagcgtggctgagaaacagaccttggatcaac
gggggccatcatcatgtccagatggcattccgcacagcacccgagcccgttcatgcgcat
ccggctggaaagcgattcggcaatgccatcaagcagcgagtacaagtactgcaagcagag
ctccacaaatatacatctcggagagtgcgacagacgccattattctctgctgagacgccg
ttcaaaggagacttccatcggctcgcacgaagactgtgcggcaagactgttgggctggtg
cttggcggcggcggtgctcgcggtcttgcgcacgtaggcatcattcgggctctcgaagag
gcgggactgccgatcgacatcgtcggtggcacgtcgataggtgctcttgttggaggagta
tatgcgcaggatgcagaggtggtgccgatgtacggtcgggtgaagaagttcgcaggtcgc
atgggcagcatgtggcgattcgcgctcgatgtcacgtatccctccgcttcgtacacgacg
gggcatgagttcaaccgcggcatcttcaagatctttggtgacagccagatcgaagatttt
tggctgtcgtactactgcaactcgacgaacatttcgaagtccagacccgagatccacacc
agcggctatgtgtggcgatatgtgcgagcatccatgtcgcttgcaggtcttttgccgccg
atgtgcgacgatgggcacatgctgctggatggaggatacacggacaacctgacggtgtcg
cacatgaaagcgctcggggcagaccagatcttcgctgtcgacgtgggcgctcttgatgac
gacactccccaagcatatggcgacagcctgtcaggactttgggcggctgtgaatcgctgg
aatcccttctcctcgcaccccaatccaccgacgctgtcggagatccaagcgcgactcgca
tacgtgagctcggtggacaatctcgcgcgtgcgaagaacatccctggttgtcgatacatg
cggcctcccatcgagacgtatggcactctggactttgggaaattcgatgagatctatcag
gtgggatacgagtacgggaagaaattcctggctgatctggatgtgcgggggaatgcagag
acggatgacaagcggaatttgaggaggacaatggctccgagaagagctagcatttga

DBGET integrated database retrieval system