KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_207690Help
Entry
MYCFIDRAFT_207690 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00730  Thiamine metabolism
pfj00790  Folate biosynthesis
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MYCFIDRAFT_207690
   00790 Folate biosynthesis
    MYCFIDRAFT_207690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfj04147]
    MYCFIDRAFT_207690
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pfj00537]
    MYCFIDRAFT_207690
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MYCFIDRAFT_207690
Exosome [BR:pfj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCFIDRAFT_207690
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pfj00537]
 Enzymes
  MYCFIDRAFT_207690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Rick_17kDa_Anti Gly-zipper_Omp Gly-zipper_YMGG
Motif
Other DBs
NCBI-GeneID: 19336611
NCBI-ProteinID: XP_007926418
JGI: 207690
UniProt: M2YZN8
LinkDB All DBs
Position
Unknown
AA seq 1449 aa AA seqDB search
MLFENQEVDAGDFGTCARRSPCWDCQCREQVLWHNPRGTTKALSSNFTIGLSTLGLTLRA
AIPTHTQTAGGAVLGLEGHRHPACAIQARSSEGCRAQSGDSRCVIASLPPTDTSQLEPTR
QAGVATENICAAELIKLITTRQRRVFLQHRGGMRNLHNSRILPVDDSAARVVVRRDQLAG
HSLIIQPASNPRFNFRQIHLFPLIIFISAKRRLKQKADNISLATTQAQALPSPASVIPAD
SASQNPPPGGYLLGNYLTDRYWEKGWDTYQKYVNGKKVESVYTPYEKRKHGGTAGHPRSA
SSSSSSSSSNSRVGRRSAPEPPPPQTQGHSLTVKSPDSGGGVAQRIARPELTGLPGAVAL
AQLPTDVRPSTYHSREEGSRRLQAEYLPISERDVGKEHTRGASTLLQQEEEYSKEIRRQY
RAETDDPRRPAAEVLPKKDLWTLDELDPPNNRQLSITGPSSKRESILKDSAASRRDSAVM
ASGYNDNYNGNTQYQGEGRARSAQPPKSRYYDDDDSDYDERSGKRTSGRGRGWDDRYDDR
DYDRVEEVTERYRGPVSAGPLVVRPSTPVDRPYATQRGDSYRSGYDAPYGAGAVTQYGRR
SDGALDRSGDRESYVSRRSKSRGRSDRDRSYSRSRSRSRSNERERGEGIRGKIEDAFDTS
GRGLATGLAGAVIGGLAGRQFGQRHQQRDILIGAVVGGLGANLAENKYREWKDEKRDREE
RWEQRYDGRSRSNKLHRKAMTRERERRDGVSWTKLDVLKHRRSLTAFGLPGRGQFAANPP
GSITTVCNRSSIVHRGSPNASCRSCETRTLDLLVNVPMITFPCIPFHCFPRLRYSPSAAS
LGMAAGDAPVIQRPPSQSSGEGGIEEEDALLTGQRTGKTPATTSTSRNADRYQRWREIGL
FVWAVIATAVVIVLAVVWQHNSQTSGKHGGSAGKGGKRNLIFMVSDGMGPTSLTLTRSWR
QYTEQLPWDETLILDEHLIGQSRTRSSSSLVTDSAAGATAFSCGKKSYNGAISVLPNFDP
CGSVMEAAKKMGYTTGLVVYNSDTDATPCRIRQPCEEKRDGGRYCTADDWRDASFGKNGG
SYDWRWEGGCRADDIDVIDVAGKKHDWNYIGKRDDFDNLGTDAKLPLLALFAPTDIPYEI
DRRHQEDVYPSLAETAKKALDILSAATQDKNQGFFIMIEGSRIDHAGHANDPAAQVHEVL
AYDRAMSAVLDFIEHSGVPTLMVSTSDHETGGLATARQLHEEYPDYLWYPSVLANASHSA
SYAAQEYYLHQQKRATTAIIETESKDEETYLKSLIKSALGIHDPTSAELSSLINHESPAS
YIFADMISRRAQTGWSTHGHSGADVNIYASDPVAAEALKGNHENIEVGQFLRDYLGVNAE
VEKVTEKLKKHMHSVGAEAFLGSVPEEQERLDGQDHLDEYHGDHKTRHKRRTWFTHRRLR
LCGDLESLA
NT seq 4350 nt NT seq  +upstreamnt  +downstreamnt
atgctattcgagaaccaggaggtagacgcgggtgacttcggtacctgcgctagacgctca
ccctgctgggattgccagtgcagagagcaggtgttgtggcataatcccagaggaacaacc
aaggcattgagctctaacttcacgataggcctgagcacactcggcctcactttgagagcc
gccattcccacacatacccagactgccggcggcgcggtccttggcttggaagggcatcgg
catcccgcatgcgccatccaagccagaagctcagaaggctgcagagcccaatcaggtgac
tcgcgatgtgtgattgcatcacttccacctactgacacctcgcaattggagccaacgagg
caggcaggcgtcgccacagaaaacatatgcgcagccgagttgatcaaactaatcaccacg
cgtcagcgacgagtctttttgcagcatcgtggtggaatgcgaaatcttcataactcacgc
attctgcccgtcgatgactcggctgctcgcgtggtcgtgagaagagaccagctcgccggt
cactcattaattatccagccagccagcaatcctcgtttcaactttcggcagatccacctc
ttccctctcatcatattcatcagcgccaaacgtcggctcaagcagaaagcagacaacata
tccctcgccacaacacaagcacaagcactgccgtccccagcctccgtcatcccggccgac
tccgcctctcagaacccgccaccaggaggctacctgctgggaaattacctcaccgaccgg
tactgggagaagggctgggatacatatcagaaatacgtcaacggaaagaaagtcgaatcc
gtctacacaccgtacgagaagcgcaagcacgggggcactgccggacacccacgctctgct
tcatcatcatcctcgtcttcgtcgtcgaacagccgtgtcggccgtcggtcagcacccgag
ccaccgccgccgcaaacgcaaggccattccctgactgtaaagtcaccagattcaggtggt
ggcgttgctcagcgaatagctcggcctgagcttaccggtttaccaggcgcagttgcgctc
gctcagcttcccacagacgtccgcccaagtacttaccactcccgagaagaaggctcccgc
cgtcttcaagctgaatatcttcccatctctgagcgcgacgtaggaaaagagcatactcgc
ggcgctagtacgttgctgcaacaagaggaagagtacagcaaagagattcgacgccagtac
cgagctgaaaccgacgatccccggagaccagcagcagaagttcttccaaagaaggacctc
tggactctagacgaactagatccaccgaacaatcgacagctcagcataacaggaccttca
agcaagcgcgaaagcattctcaaagactcggccgcgtcgagacgagacagcgccgtgatg
gcatccggatacaacgacaactataatggtaacacgcagtaccaaggcgaaggtcgtgca
cgctcggcgcaaccgccaaagagtcgatactacgatgacgacgatagcgattatgacgag
cgtagcggaaagaggaccagtggtcggggtcgtggatgggatgatcgatacgacgatcgc
gactacgaccgcgtagaggaggtgactgagcggtacagaggccctgtaagtgcaggacca
ctcgtcgttcgtccatcaacccctgttgaccgcccttatgctacgcagagaggcgacagc
taccgatctggatacgatgcaccatatggagctggtgcagtaacacagtacggtcgtcgg
tcagatggtgcccttgatcgctcaggagatcgcgagtcgtatgtcagtcgccgctccaag
tctcgaggtcgcagcgatcgcgacagatcttactcgcgatcccgttcccgaagccgaagt
aatgaacgcgagcgaggcgaaggaatccgtggtaagattgaagatgccttcgacacctct
ggtcgtggtcttgctactggtctcgccggagctgttattggcgggcttgcaggaaggcaa
tttggccagagacatcagcaacgcgacatactgataggcgcagtcgttggaggactcggg
gcaaatctcgccgaaaacaagtaccgcgaatggaaagatgagaagcgggatcgggaggaa
cgatgggagcagagatatgatggccgcagcaggagcaataagctgcatcggaaggccatg
actagagagcgagagcgacgcgacggagtctcttggaccaagcttgatgttcttaaacat
cgtcgctctcttacagcctttggcctgcctggtcgcgggcaatttgcagcaaatccgcct
ggcagcattaccactgtctgcaaccggagctctatcgtacatcgcggctccccaaatgcg
tcatgtcgttcatgtgagacacggacccttgatctcctcgtgaacgtccccatgatcaca
tttccctgcattccattccattgcttccctcgtttacgctacagccccagcgctgcatcc
cttggtatggccgcaggtgacgcgccagtaatacaacgtcctccctctcagagcagcggc
gaaggcggtattgaggaagaagatgcactcctgacaggccagcgaaccggcaaaaccccc
gccacgacgagcacatcacggaatgcggatcgatatcagcgatggcgagaaataggacta
ttcgtatgggcggtgatagcaacagccgttgtgatcgtgctggctgtggtgtggcagcac
aactcgcagacatcaggcaagcatggcggcagtgcaggaaaaggaggaaagaggaatctc
attttcatggtcagcgatggtatggggccaacatctcttaccttgacaaggagttggaga
caatatacagaacaactgccttgggacgagaccctcattcttgatgagcatttgattggg
cagtcgaggacgaggagttcgagttcactggtcacagacagtgctgcgggagccacggcg
ttcagttgcgggaagaagtcttataatggagcaatatctgtactgccaaacttcgatccc
tgtgggagtgttatggaggctgcgaagaagatgggatatacgacgggactggttgtttac
aactcggatacagatgctacgccttgccgtattcgccagccatgtgaggagaagagagat
ggaggacgatattgcactgcagatgattggcgagacgcatcctttgggaagaatggtgga
tcttatgattggaggtgggagggaggatgcagagctgatgacattgatgtgattgacgtt
gcgggaaagaagcatgactggaattatatcggcaagcgagacgactttgacaacttgggc
actgatgcaaagttgccgttgctggctctcttcgcgccgaccgacattccatatgagatt
gatcgtcggcatcaggaagacgtctatccgtcgctggcagaaactgcgaaaaaggctttg
gatatcctcagcgcagcaacgcaggacaagaatcaaggtttcttcatcatgattgaaggc
tcaagaatagaccatgccggtcacgccaacgacccagcagcacaagtccacgaggttttg
gcttacgaccgcgccatgtccgccgttctcgacttcatcgagcattctggtgtgccgacc
cttatggtcagcacatccgaccacgaaacgggaggtctggccacagcccgtcaactccac
gaggaatacccagattacctctggtacccttcagtcctcgcaaacgcctcccattccgcc
tcgtacgctgctcaggaatactacctccaccaacagaaacgggcaacgacagctatcatc
gagacagaatccaaagacgaagaaacctacctcaaatctttgatcaaatcagccctcggg
atccacgacccaacttccgcggaactctcctccctaatcaaccacgaatccccagcctcc
tacatcttcgccgacatgatctcccgccgagcccaaacaggctggtcaacccacggccat
tccggcgcagatgtcaacatttacgcatccgaccccgtcgccgcagaagctctaaaggga
aaccacgaaaacatcgaagtcggccaattccttcgagattaccttggtgtgaatgcggaa
gtggagaaagtcacggagaaattgaagaagcatatgcatagcgttggcgcggaagcgttt
ttgggcagcgttcctgaggagcaagagaggttggatggacaggatcatttggatgagtat
cacggcgatcataagacgaggcataagaggaggacatggtttacacatcgacgccttcgt
ctctgtggggatctggagagcctggcataa

DBGET integrated database retrieval system