KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_214176Help
Entry
MYCFIDRAFT_214176 CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00410  beta-Alanine metabolism
pfj00430  Taurine and hypotaurine metabolism
pfj00650  Butanoate metabolism
pfj01100  Metabolic pathways
pfj01110  Biosynthesis of secondary metabolites
Module
pfj_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYCFIDRAFT_214176
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MYCFIDRAFT_214176
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYCFIDRAFT_214176
   00430 Taurine and hypotaurine metabolism
    MYCFIDRAFT_214176
Enzymes [BR:pfj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MYCFIDRAFT_214176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 19338004
NCBI-ProteinID: XP_007923604
JGI: 214176
UniProt: M3ANW5
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MVHLGRVATDKDLADKLVPGLEDLDLSYIPEEDEFTASVYGSKYAAADLPRHEMPENEMP
REVAYRMIKDDLTLDGVPTLNLASFVTTYMENEAEKLMVEAFSKNFIDYEEYPVSADIQN
RCVSMIARLFNVPTHDENTNAMGTSTIGSSEAIMLGTLAMKKRWQNKRKAEGKDYSRPNI
VMNSAVQVCWEKAARYFDVEEKYVYCTNDRFTIDPEEAVNLVDENTIGICSILGTTYTGE
YEDTKKINDLLIERNIDCPIHVDAASGGFVAPFVNPNLVWDFRLEKVVSINVSGHKYGLV
YPGVGWVVWRDPEFLPKELIFNINYLGADQASFTLNFSRGASQVIGQYYQLIRLGKKGYR
SIMFNLTRTADYLSAAVQKMGFILMSQTKGRGLPLVAFRLNPEHGHMFDEFAIAHQLRER
GWVVPAYTMAPHAEKLKMMRVVVREDFSRSRCDALVKDIALALHELKSLDEKSLQQQKEH
MKMQQVAKHWRKKINNHYADEDHSLKGKHGKTHGLAI
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttgggcagagtcgcgaccgataaagatctggcggataagctggttccaggt
ctcgaggacttggatctctcttacattcctgaggaggatgaattcactgccagcgtctac
ggctccaagtacgccgcggcagatctgcctcgacatgagatgccagagaatgagatgccg
cgagaggtggcttaccgcatgatcaaggacgatctgacattggacggtgttccaactttg
aacttggcctcattcgtgaccacctatatggaaaacgaagccgagaagctcatggtcgag
gctttcagcaagaacttcatcgattatgaagagtatccagtctcagccgacatccaaaac
cgctgcgtctcaatgatcgctcgtctcttcaatgtcccaactcacgacgagaacaccaat
gccatgggtaccagcaccatcggctcttcggaagccatcatgctggggaccttggctatg
aagaagcgttggcagaacaagcgaaaggccgagggtaaagattactcgagaccgaatatt
gtcatgaactctgccgtgcaggtctgttgggagaaggccgcgaggtatttcgatgtcgaa
gagaagtacgtctactgcaccaacgaccgcttcactatcgatcctgaagaggcggtgaac
cttgttgacgagaataccatcggtatttgttccattctgggcaccacgtacacgggtgag
tacgaggacaccaagaagatcaacgaccttttgatcgagcgaaacattgactgtccaatc
cacgtcgatgccgcttctggtggattcgttgctccattcgtcaaccccaacttggtctgg
gacttcagacttgagaaggtcgtctccatcaatgtctctggacacaagtacggactcgtg
tacccgggtgttggatgggtggtctggagagacccagagttcctgccaaaggaactcatc
ttcaacatcaattacctgggcgccgaccaagcctcttttaccctgaatttctcccgagga
gcatctcaagtgatcggacagtactaccagctgatccgtctcggaaagaaggggtaccgc
agcatcatgttcaacttgacgcggacggcggactacctttctgctgcagtgcagaagatg
ggattcatcctgatgtcgcagaccaagggtagaggtctaccactcgtggcattccgcctc
aatccagaacatggccacatgttcgacgagttcgccattgctcatcagctccgagaacgt
ggctgggtggttccagcgtacaccatggctccacacgccgagaagctgaagatgatgcgt
gtcgtggttcgcgaagacttctccagatcgagatgtgatgctctagtcaaggacatcgct
ctggctctgcacgagctcaagagtctcgatgagaagtcattgcaacagcagaaggagcac
atgaaaatgcagcaggttgccaagcattggcggaagaagatcaacaaccactatgccgat
gaggatcactcgctcaagggcaagcatggcaagacgcatggcctagcgatttag

DBGET integrated database retrieval system