KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_36361Help
Entry
MYCFIDRAFT_36361  CDS       T03109                                 

Definition
(RefSeq) glycoside hydrolase family 15 carbohydrate-binding module family 21 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00500  Starch and sucrose metabolism
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_36361
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MYCFIDRAFT_36361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 19339115
NCBI-ProteinID: XP_007925752
JGI: 36361
UniProt: M3B0B8
LinkDB All DBs
Position
Unknown
AA seq 642 aa AA seqDB search
MRWPSSILTAGISLLRCTFAFAQSCNTTVLHVDTPSQGNVVFKSFSYCGGILSTSAYINN
LAYNKLVNLYFTNRQDQSTPLTSIGLRYNSSVDGTPYELWASSTPVYVDGITKLLNITYD
VVDTGSEYNQVLNLDVVASGAPEPTLPGPPQPYATPKGFSDDITDFLEVANGSQLVASLN
KMFANINPAIEGAVDGVVVAGRSGPFFESKLPDYGYDWVRDSSLTMDVVQTLYAAANNSN
AKQQYEAILFQYALARATEQTAPNLQTGLGEPKFYLNNTVYEKPWGRPQNDGPATAATTL
IEFAESYLAAGGNLSTVKEKLYDSATYPATAPMRKDLLFVASNWTSASFDLWEEESADHF
YTRMVQRRALVLGSKFAETMDDHETAATLKSALDALTATMSQFWDVNRGILLYEYGPVLL
GKSSYLDAAVPLGLIHGYANDTVFSYTNDQVLSTVVRFVTSFTETYPLANKTQTDGSGLT
LGVPIGRYPEDVYNGTGTEENGGNPWYLTTAAIAQVMYAASDEYNSAENLTVTNTSLSFF
EYFVPDAELEVGQTYVIDSQEFSKVIGSLNGWGDAFLRTVKYYTPSDGSLAEEYNRDDGV
PQGCVDLTWSYASIITAAIQRAKTRNEDDFVRDLANLGITPN
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggccatcttccatactgacagccggtatcagcctgctgcgatgcaccttcgcc
ttcgcccagtcttgcaacaccacagtactgcacgtcgatacaccaagtcaaggcaatgtg
gtattcaaaagtttcagctactgcggcggcatcctgagcacttctgcatacatcaataat
cttgcatacaacaagctggtcaacctctatttcacgaatcgacaagaccaaagtacacca
ttgacgtcgatcggactgcgctacaacagcagtgtcgatggcacgccatacgagctttgg
gcatcaagcacgcctgtctacgtcgatggcatcacgaagcttctcaatatcacttacgat
gtagtcgataccggaagcgaatacaaccaggtcctcaatctggacgttgtcgcgagtggt
gcaccagagcctacactgcctgggccaccacaaccttacgccacgccgaaaggcttcagt
gacgacatcaccgatttcctcgaagtggccaatggctctcaacttgtggcctcactcaac
aagatgttcgcgaacatcaatccagctatcgaaggagcagtcgatggcgtggtagtcgca
ggacgaagcggaccattcttcgaatcgaagctgccagattatggatacgactgggtccga
gattcgtccttgacaatggatgtcgttcagactctgtacgcagctgctaacaacagtaac
gccaagcagcaatacgaagccattctcttccagtacgcacttgctcgtgccacagagcag
accgccccaaacctgcagactggtttaggagagcccaagttctacctgaataatacggta
tacgaaaagccttggggacgacctcagaatgacggaccagctacagctgcaaccacgctt
attgaatttgctgagagctatctcgcagcaggtggtaatctttctactgtgaaggagaag
ctctacgattccgctacttatcctgcaaccgcaccgatgcggaaagatctgcttttcgtt
gccagcaattggacttcagcctcatttgacttatgggaggaagaaagtgcggatcacttc
tacacgcgtatggtgcagcgtcgcgctctcgtcctgggcagcaaattcgcagagactatg
gatgaccatgagactgcggcaactctgaagtctgctcttgatgctctgactgcgacaatg
agccagttctgggacgtcaaccgaggcatattgctgtacgaatacggtccagtacttctc
ggcaagtcgagctatctggatgctgcggtccctcttggcctcattcatggttacgcgaac
gataccgttttcagctacaccaacgaccaagttctatccactgtcgtgcgcttcgtcacc
agcttcaccgagacatacccgctcgcgaacaaaacgcagacagatggctccggcctgact
cttggtgtgcccattggacgctaccccgaagatgtgtacaatggaacagggaccgaggag
aacggtggaaatccttggtacctcactactgccgcgatcgcgcaggttatgtatgccgca
tccgatgagtacaactcggccgagaatctcaccgtcaccaacacctcgctgagctttttc
gagtacttcgtcccagatgctgagcttgaagtgggccagacgtatgtcatcgacagccag
gaattttcaaaggtcatcggaagcctgaacggttggggcgatgcgttcctgcgaactgtg
aagtactatacgccatcggatggatctctcgcggaagagtacaatcgtgatgatggcgtt
ccgcaaggctgtgtcgacctgacttggtcttatgcgagcataatcacggctgccatccag
agagctaagactaggaacgaggatgactttgtccgagacctcgccaatctaggcatcacc
cccaattag

DBGET integrated database retrieval system