KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_52473Help
Entry
MYCFIDRAFT_52473  CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
pfj  Pseudocercospora fijiensis
Brite
Translation factors [BR:pfj03012]
 Eukaryotic Type
  Elongation factors
   MYCFIDRAFT_52473
 Prokaryotic Type
   MYCFIDRAFT_52473
Mitochondrial biogenesis [BR:pfj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MYCFIDRAFT_52473
Exosome [BR:pfj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MYCFIDRAFT_52473
  Exosomal proteins of breast cancer cells
   MYCFIDRAFT_52473
  Exosomal proteins of colorectal cancer cells
   MYCFIDRAFT_52473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 19340029
NCBI-ProteinID: XP_007922555
JGI: 52473
UniProt: M3A4P5
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MSFATKLMRTSRALRTQTPIQTALHSAQYQFAASATATARTYATVFERSKPHVNIGTIGH
VDHGKTTLTAAITKRQAEKGYANFLDYGAIDKAPEERKRGITISTAHIEYQTDNRHYAHV
DCPGHADYIKNMITGAASMDGAIIVVAASDGQMPQTREHLLLARQVGVKRIVVFVNKVDA
VEDKEMLELVEMEMRELLSSYGFEGDETPIIMGSALCALEGREKEIGETKIDDLLAAVDE
WIPTPERDLDKPFLMSVEDVFSIPGRGTVASGRVERGVLKKDSEVELVGKNKTPIKTKVT
DIETFKKSCDQSQAGDNSGLLLRGVKREDVQRGMVVALPGTAKSHKKFLTSMYVLTKEEG
GRHTGFANNYKPQLFLRTADEAAALSWPEGSEQAAENKMVMPGDNVEMVCEIHKPLAIEQ
GQRFNVREGGRTVATGLITRLLD
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgctaccaagctgatgcgcacctctcgcgccctgcgcacgcaaactcccatc
cagaccgcactgcacagcgcccagtaccagttcgccgcatccgcaacggccaccgcgaga
acatatgccaccgtattcgagcgcagcaagccgcacgtcaacatcggtaccatcggccac
gtcgatcacggaaagacaacattgacggccgccatcaccaagcgacaagcagagaagggc
tatgccaacttcctcgactatggcgcaattgacaaggcgcccgaagagcgaaaacgtggt
atcaccatctcgaccgcacacatcgaataccaaaccgacaaccgccactatgcccacgtc
gactgtcccggtcacgctgattacatcaagaacatgattactggtgctgcatccatggat
ggtgccataattgtcgtcgctgcttccgatggacagatgccacagaccagagagcacttg
ctgctcgcccgccaggtcggcgtcaagagaatcgtcgtcttcgtcaacaaggtcgatgct
gttgaggacaaggagatgttggagctcgtcgagatggagatgcgtgagctgctttcatca
tacggcttcgagggtgacgaaaccccaatcatcatgggttccgcactttgcgctcttgag
ggccgtgaaaaggagattggcgagaccaagatcgatgatctcctcgcagctgttgacgaa
tggatcccaaccccagagcgcgacctcgacaagccattcttgatgtctgttgaggacgtc
ttctcgattccaggacgtggaactgtcgcctctggtcgtgtcgagcgtggcgtgctcaag
aaggattccgaagtcgagctcgttggcaagaacaagacccctatcaagaccaaggtcacc
gacattgagacattcaagaagtcctgcgaccaatcgcaagctggtgacaactccggtctg
ctccttcgtggtgtcaagcgtgaggacgtccagcgtggtatggttgttgcattgccaggc
actgccaagtctcacaagaagttcttgacttccatgtacgtccttaccaaggaagaaggt
ggtcgccacactgggttcgcaaacaactataagccacagctctttctccgaactgccgat
gaggccgctgctttgagctggcccgagggttcagaacaggctgctgagaacaagatggtc
atgcctggcgacaacgtcgaaatggtctgcgagatccacaagccacttgccattgagcag
ggtcagcgattcaacgtacgtgagggtggacgaacagttgccactggcctcatcacccgt
ctcttggactaa

DBGET integrated database retrieval system