KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_53449Help
Entry
MYCFIDRAFT_53449  CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00071  Fatty acid degradation
pfj00280  Valine, leucine and isoleucine degradation
pfj00592  alpha-Linolenic acid metabolism
pfj01040  Biosynthesis of unsaturated fatty acids
pfj01100  Metabolic pathways
pfj01110  Biosynthesis of secondary metabolites
pfj01130  Biosynthesis of antibiotics
pfj01212  Fatty acid metabolism
pfj04146  Peroxisome
Module
pfj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYCFIDRAFT_53449
   00592 alpha-Linolenic acid metabolism
    MYCFIDRAFT_53449
   01040 Biosynthesis of unsaturated fatty acids
    MYCFIDRAFT_53449
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCFIDRAFT_53449
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MYCFIDRAFT_53449
Enzymes [BR:pfj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     MYCFIDRAFT_53449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 19340084
NCBI-ProteinID: XP_007922585
JGI: 53449
UniProt: M3ALF2
LinkDB All DBs
Position
Unknown
AA seq 413 aa AA seqDB search
MATERVKSVLGHLLPGQKPLDHITQKNPDDIVITLAIRTPLAKGKKGGLKDTPLDGIVFK
LLEQVRHKSRLDPQLVEDICLGNVSDAKAAYYCRAALLAAGYPNTTAGSSVNRFCSSGLK
AVQDIANQIITGSIEVGIAIGAESMTAGGDRLTRPFVDDILNANQEARDCLQPMGQTSEN
VGKDFNISREMQDRYAAESYRRAEVAQKAGWFDDEIAPIKVQLDGKQVTLTRDEGPRYGT
TFESLSKIRPAFPDYGDRSTGGNSSQVTDGAAAVLLMKRSKALELGQPIMAKYVGATVAG
LAPRIMGIGPSIAVPKLLTKYGLTVDDIDIFELNEAFASMAVYCRDTLKLDWQKMNPRGG
AIALGHPLGCTGARQIVTGLSECRRQQKKILLTTMCIGTGQGMAGLFVNEQNV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggccacagaacgagtaaagagcgtcctcggacatctccttccaggccagaagcctttg
gaccatatcacgcaaaagaacccagacgacattgtcatcactctcgcgatacgaacgcct
ctcgcaaaaggcaagaagggaggtctgaaggacactcctctcgatggcattgttttcaag
ctcctcgagcaagtccgacacaagagccgattggacccacaattggttgaagatatctgc
ttaggaaatgtctccgatgcaaaagctgcctactactgccgtgctgccctcctcgcagca
ggctacccaaacaccaccgccggctcttcagtgaaccgcttctgctcctcaggcctcaaa
gccgtccaagatatcgccaaccagatcatcaccggcagcatcgaagtcggcatcgcaatc
ggagcagaatcgatgaccgcaggcggcgaccgcctgacgcgcccattcgtcgacgacatc
ctcaacgccaaccaagaagcccgcgactgcttgcagcccatgggccagacttctgagaac
gtgggaaaagatttcaacatcagtcgtgaaatgcaggacagatatgctgccgagtcatac
cgacgtgctgaggtcgctcagaaggcaggctggttcgatgatgagatcgctcccatcaag
gtccagctcgatggcaaacaggtcacgctcactcgcgacgaaggtccaagatacggaact
actttcgaatctctttcgaagattcgtccagcgttcccagactatggtgacaggtcgact
ggtggcaacagttcgcaagtgaccgacggtgccgccgctgtcctgttgatgaagcggtcc
aaggctctcgagctgggccagccaattatggccaaatatgttggcgcaacggtcgcgggt
cttgcaccacgtatcatgggcattggcccatcgatcgccgtgccaaagctccttactaag
tacggtctgaccgttgacgacattgatattttcgagctcaatgaggctttcgcttccatg
gcggtatattgtcgcgacacactcaagcttgactggcaaaagatgaatccgagaggtggc
gctatcgctctcggtcacccgttgggatgcacgggtgcaagacaaattgtgaccggtctg
agtgaatgcagaagacagcagaagaagattctgcttacgaccatgtgcattggtactggc
cagggtatggcaggtttgttcgtgaatgagcaaaatgtatag

DBGET integrated database retrieval system