KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_55413Help
Entry
MYCFIDRAFT_55413  CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
Organism
pfj  Pseudocercospora fijiensis
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19340213
NCBI-ProteinID: XP_007920152
JGI: 55413
UniProt: N1Q7X2
LinkDB All DBs
Position
Unknown
AA seq 273 aa AA seqDB search
MSTNGPSKELDPNQGGDASKKTYHKKATGEALQTAVSHAASKDLKLYGSCFCPFVQRVWI
SLELKGLDYEYVEVDVYRKPKLLLDINPRGLVPALRHGAWGCYESTVLMEYLEDLHEGRA
LLPEDPKSRASARLWSDHINRHIIPLFYKYLQAQEPDDQVKFAGDLKGQIAKIVEVADQD
GPFFFGSEMGFVDVQFAPWIVRLEKVLKPYRGWPDAEPGSRWDRWVRSVVEAEPVRKTTS
TDELYLDSYERYAENRPNTSQVRDAINSGGGLP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaacggtccgtcgaaagaacttgacccgaaccagggtggcgatgcgagcaag
aagacataccacaagaaggcgaccggagaggcgctgcagactgcagtttctcatgccgct
agcaaagacctcaaactctatggttcatgcttttgcccttttgtccagcgggtttggata
tcgcttgagctcaaaggtcttgattacgagtatgtggaggttgacgtctaccggaagcca
aagcttctgcttgacattaaccccagaggactcgttccggctttgagacatggcgcatgg
ggatgttatgagagcacagtgttgatggagtacctcgaagatttgcacgaaggccgagca
cttttgcctgaggatcccaaatcgcgagcctccgctcgcctttggtctgaccacatcaac
cgacacattattcctctgttttacaagtaccttcaagcccaagagccagatgatcaagtc
aaatttgcaggagacctcaaaggtcagatagccaagatcgtagaggtggctgaccaggac
ggaccatttttcttcggatcagagatgggctttgttgatgtacagtttgcgccttggatt
gtcagactcgagaaagtgctaaaaccgtaccgaggctggccagatgccgagcctggttcg
cggtgggatagatgggtgcgttctgtagttgaagcagagccggtcaggaagactacaagc
acggacgaattatacctggatagctacgagagatacgctgagaatcgaccgaacacatcc
caggtgagagatgccatcaactctggtggtggtttgccttga

DBGET integrated database retrieval system