KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_59285Help
Entry
MYCFIDRAFT_59285  CDS       T03109                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00052  Galactose metabolism
pfj00500  Starch and sucrose metabolism
pfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MYCFIDRAFT_59285
   00500 Starch and sucrose metabolism
    MYCFIDRAFT_59285
Enzymes [BR:pfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MYCFIDRAFT_59285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19340510
NCBI-ProteinID: XP_007922622
JGI: 59285
UniProt: M3AN82
LinkDB All DBs
Position
Unknown
AA seq 948 aa AA seqDB search
MLQQFFAGAVFAASASARALIPRQATTVCPGYSASNVQTHDSGLTASLSLAGSACNSYGK
DIEHLKLLVNYDSTNRLHVKIEDDPSVAYQVPTSVFPTPHASSSVPADESALQFDWTDTP
FTFSVKRRSNGEVLFDSSAAPLIFQDQYLRLRTSLPANPNLYGLGEHSDNFRLDTTNNTR
TLWSRDSYGIPAGTNLYGNHPVYFDHRGADGTHGVFLLSSSGMDVKIDVTETGEQFLEYN
LMSGILDLYFVAGPSPIEVSKQYAEISGFSAMMPYWGFGFHQCRYGYRDFYAIAEVIANY
STANIPLETMWTDIDYMYERYIMTTDPDRFSLPRVRDIVNYLHEHDQHYIVMVDPAVAYQ
EKKYDDLPYETFLTGQDNGYFLQKDGTTYKGVVWPGVTAFPDWFHPDVQEYWDKEFINFF
SAETGVDIDALWIDMNEAANFNYFGDNPEETQEERGFPPTRPALRSQPRPIPGFGPEFQP
GAQPYPPDDYAYAPPWLAPDSNPGENKVKRSAKTPAATPKRQATTSPSGANVIGYPNRNY
LSPPYQIDNENTYEDYGGPSNFTLDTDIVHYDGHVELDVHNLYGTMMSEASRHAMLARRP
ERRPLVITRSTFAGAGRSVGKWLGDNLSTWELYRNSIQGMLNFASIFQVPMVGSDICGFG
ANTTETLCARWATLGAFYPFMRNHNGDTSIPQEFYLWETVAEAARGALDIRYRLLDYIYT
AMHKQSQDGSPLLNPLFYLYPEDKNTFGVELQFFYGDSLLVSPVTEENKTSVTIYLPEDR
FYNWGTWDTVEGTGANITLENIGFTEIPLMVKGGSCIPVRKSSGYTTTETRKQPFDIIVA
PGKDGKASGSLYLDDGDSVEQTATSEITFTYENGVLDIGGTFGYTAEDNRIASVTVLAVQ
AKGGRPSWRRRGQGWKECRQNNWSHDGERGVTTVDINQPLDGELSVSL
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagcagttttttgctggagctgtctttgcagcatctgcttccgcaagggcttta
ataccccgacaagcgacgactgtatgcccaggatactccgccagcaatgtacagacacac
gactccggattgacggcatctttgtcactggctggatcagcgtgcaattcctatggaaag
gacattgagcatttgaagttgctggtgaactacgactcgacaaatcgtttgcacgtcaaa
attgaagacgacccttccgtcgcctaccaagtgccaacttccgtctttccaactccacat
gcctcttcctcagtccctgcagacgagtctgcacttcaatttgactggacagacactcca
ttcacattctccgtcaagagacgcagcaatggcgaagtcttattcgactcctcggcagca
cctctaatcttccaagatcaatatctccgtctgcggaccagtcttcctgcgaatcccaat
ctatatggacttggcgagcactcggacaacttccggctcgataccaccaataacacgcgc
actctctggagccgagattcctacggcattccagcaggcacaaatctgtacggaaaccac
ccagtatactttgatcaccgtggcgcagacggaacgcatggagtcttcctgctgtccagc
tctggcatggacgtaaaaattgacgtgaccgagaccggcgagcaattccttgagtacaac
ctcatgtctggcattctagacctgtattttgtagcaggtccatccccgatagaagtgagc
aagcagtacgcggagatatccgggttttcagcaatgatgccctactggggattcggcttc
caccaatgccgttatggctacagagacttctatgccatcgcagaagtgatcgccaactac
tccactgctaacatccctctcgaaacgatgtggacggacatcgactacatgtacgagcgc
tacatcatgactacagaccccgatcgtttctcactcccgagagtacgagacattgtcaac
taccttcacgagcacgaccagcattacattgtcatggtggatccagcagtggcgtatcag
gagaagaaatatgacgatctgccttacgagacattcttgactggccaagacaacggctac
tttttacagaaggatggaactacttacaagggtgtagtctggcctggtgtcaccgctttc
cctgattggtttcatccagacgtccaagaatactgggacaaggaattcatcaacttcttc
agcgccgagactggtgtggacattgacgcactctggattgacatgaacgaagctgccaac
ttcaattattttggagacaacccagaggagactcaggaggaaaggggcttcccgcctact
cgaccagctttgcggtctcagccgagacctattccaggtttcggccccgagtttcagcct
ggtgcgcagccatacccacctgatgattatgcctacgctccaccatggctagctccagac
agtaacccgggcgagaacaaagtaaagcgatccgccaagactccagctgccactccgaag
cgacaggcgacaacttcacctagtggagccaacgtgatcggataccccaatcgcaattat
ctttcccctccttaccagatcgacaacgagaacacatacgaggactacgggggtccttca
aatttcacacttgacacggatattgtccattacgatggccatgtcgagctcgacgtgcac
aatctttatggtaccatgatgagtgaagcatcgcgtcacgcaatgctggctcgtcgaccg
gagcggcgtcctttggtcatcactcgttccacattcgctggcgctggccgcagtgttggc
aagtggcttggagacaatctctccacatgggagctgtaccggaactccatccagggaatg
ctgaacttcgcaagcattttccaggtgccgatggttgggagtgatatctgtggctttggc
gcaaacacgaccgagaccttgtgtgctcgctgggctacacttggcgctttctatcctttc
atgcgcaatcacaatggcgacacttcgatcccgcaggagttctatctctgggagaccgtc
gcagaagccgctcgcggtgctcttgacattcgataccgattgctagactacatctacact
gccatgcacaaacagtcacaggacggatccccattactcaatccactcttctatctttac
ccagaggacaagaacacattcggagtcgagctccaattcttctacggcgattccctgctg
gtgtctcccgtgaccgaagagaacaaaacgagcgtgaccatatacctgcccgaagaccgt
ttctacaactggggaacctgggacaccgtggaaggtacaggggccaacatcacgttggaa
aatattggcttcactgaaattccactcatggtcaagggtggctcatgtatcccggtgagg
aagtcatccggatacaccaccacagagacccgcaaacagccattcgacatcatcgtggca
cctggcaaagacggcaaagctagcggttcgctttacctcgatgacggcgacagcgtggag
caaactgcaacttcggaaatcacgttcacctatgagaacggtgtgctggatattggcggc
acgttcgggtacacggctgaggataatcgtatagcctcggtcactgtgttagccgtccaa
gcgaaaggcgggcgaccttcgtggaggaggcgaggtcaaggctggaaggaatgtcgtcag
aataactggtctcacgacggcgagcgcggtgtgacgacggttgatatcaatcagcctctt
gatggagagctttctgtgagcctatag

DBGET integrated database retrieval system