KEGG   Pseudocercospora fijiensis: MYCFIDRAFT_87948Help
Entry
MYCFIDRAFT_87948  CDS       T03109                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pfj  Pseudocercospora fijiensis
Pathway
pfj00020  Citrate cycle (TCA cycle)
pfj00190  Oxidative phosphorylation
pfj01100  Metabolic pathways
pfj01110  Biosynthesis of secondary metabolites
pfj01130  Biosynthesis of antibiotics
pfj01200  Carbon metabolism
Module
pfj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pfj_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pfj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCFIDRAFT_87948
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MYCFIDRAFT_87948
Enzymes [BR:pfj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MYCFIDRAFT_87948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 19342641
NCBI-ProteinID: XP_007930389
JGI: 87948
UniProt: M2ZL25
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MAQSMRRAFLDATSAFRTTSPSITSQSSPVWRRRSTPNASQNSTSQRRTYLGQTQRRRAT
TSAETTFSKYPIIDHHYDAIVVGAGGAGLRAAVGLAESGLETACITKLFPTRSHTVAAQG
GINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCREAPKAVYELENYGMAFSRTED
GRIYQRALGGQSLNYGKGGQGVRCCSAADRTGHAMLHTLYGQSVKHNTNFFIEYFAIDLL
MVDGECVGVLCMSMEDGTLHRVFARNTVLATGGYGRTYFSATSAHTSTGDGNAMASRAGL
PNQDFEFIQFHPTGIYGAGVLITEGSRGEGGYLLNSNGERFMERYAPTAKDLASRDVVSR
SMHMEIRAGRGVGPEKDHVYLQLSHLPKDLIMERLPGIAETASVFSGVDVTKEPIPVLPT
VHYCMGGVPTNWKGEVLNVDPSSGKEKVVKGLYAAGEVACVSVHGANRLGANSLLDIVVF
GRACALDIASKNSKGQPHSPVPENIGMDSLDCMEKIRCADGEKLSAEIRADMQRIMQSEI
SVFRTREALERGNSKMQSVQTDFETRLAVRDRSMIWNSDLIETLELRNLLTCAAQTAKSA
LLREESRGSHAREDFVERDDEHWMKHTLSWQRNVGEEVRIGYRGVVMGTLDEGEMGSIPP
VRRTY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcacaatcaatgcgaagagccttcctggacgccacctcggcctttcgaacgacctcc
ccatcaatcacatcacaatccagcccggtgtggcgaagacgaagcactccaaacgcgtcc
caaaacagcacaagtcagcgaagaacctaccttggtcagacacaacgaagacgagccaca
acttcggcagaaaccacattctccaagtatcccatcatagatcaccactacgatgccatt
gtcgtgggagctggtggcgcaggcctcagagcagctgtgggtctagcagagtccggcttg
gaaacagcatgcatcacgaaactgttccccactcgatcgcatacggtagccgcacaagga
ggaatcaatgcagcactcggcaacatgactgaagacgactggcggtggcacatgtatgac
acagtaaaaggaagcgattggctcggagatcaagatgcaatacattatatgtgcagagag
gctccaaaagcagtgtatgaattggagaactacggcatggctttctcgcggacagaagac
ggcagaatataccaacgagcactgggagggcaaagcttgaactatggcaaaggtggccaa
ggtgtgcggtgctgctcggctgccgatcgaacagggcatgctatgttgcacacactgtac
gggcagagtgtgaagcacaacaccaacttcttcatagaatactttgcgatagatttgctc
atggtcgacggtgaatgcgtcggcgttctctgcatgtcaatggaagatggtactctgcac
agagtatttgcgagaaacaccgtccttgcgacaggtggatatggacgaacgtacttttca
gctacgtcagcacacacctcgacaggagacggcaatgccatggcatcacgagcgggtctg
ccaaaccaagacttcgagttcattcaattccaccctacaggcatctatggcgccggtgtg
ctgatcacagaaggatcgagaggtgaaggcggctaccttctaaacagcaacggcgagcgc
ttcatggaacgatacgcacctacggccaaagacctagcatctcgcgacgtagtctctcga
agcatgcacatggagattcgagcaggacgcggcgtaggaccagagaaagatcacgtctac
ctccaactcagccatctccccaaagacctcatcatggaacgcctcccgggaatcgcagaa
accgccagcgtcttcagcggcgtcgacgtaacaaaagaacccatccccgtcctccccaca
gtccactactgcatgggcggcgtccccacgaactggaaaggcgaagtcctcaacgtcgac
ccctcgagcggcaaagaaaaagtcgtcaaaggcctctacgccgccggagaagtggcctgc
gtcagcgtccacggcgcaaaccgtctgggcgccaacagcctcctcgacatcgtcgtcttc
ggccgagcctgcgccctcgacatcgcctcgaaaaactcaaaaggccaaccccacagcccc
gtccccgaaaacatcggaatggactctttggactgcatggaaaaaatccggtgcgcagat
ggagagaaactcagcgcggaaatccgtgcggacatgcaacggatcatgcaatctgaaatt
tccgtcttccgcactcgcgaagctttggaacgagggaattcgaaaatgcagagtgtgcaa
acagatttcgagacgaggttggcggtgagggatcgcagtatgatttggaattcggatttg
attgagacgttggagttgaggaatttgttgacgtgtgcggcgcagacggcgaagagtgcg
cttttgagggaggagagcagggggagtcatgcgcgagaggattttgtggagagggatgat
gagcattggatgaagcatacgctttcgtggcagcgaaatgttggggaggaggtgcggatt
gggtatagaggggttgtcatggggactttggatgagggggagatggggagtattccgcct
gttaggaggacgtattag

DBGET integrated database retrieval system