KEGG   Pseudomonas frederiksbergensis: PFAS1_00235Help
Entry
PFAS1_00235       CDS       T04786                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pfk00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PFAS1_00235 (ligD)
Enzymes [BR:pfk01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PFAS1_00235 (ligD)
DNA repair and recombination proteins [BR:pfk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PFAS1_00235 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: APV37844
UniProt: A0A1P8ENN1
LinkDB All DBs
Position
complement(49078..51669)
Genome map
AA seq 863 aa AA seqDB search
MSRSLDDYNRMRDFSATSEPAAGKRSGKKTAKDHALQFCIQKHDASRLHYDFRLELDGAL
KSWAVPKGPSLDPKVKRLAVHVEDHPIDYATFEGSIPEGHYGAGDVIVWDRGVWIPQDDP
AEAYAKGKLKFELKGEKLGGLWNLVRTHMPGKQEQWFLIKHQDGAARPESDYDVVAAEPD
SVLSDRTIVAKKPKTAAKPKPVKKPASPARNEKSAPLTGARKAKLPEMLKPQLATLVEKA
PGGEWSYEIKFDGYRIMARIDHDEVKLFTRNGHDWTHKLPRQAEALAALGLESAWLDGEM
VVANEQGVPDFQALQNAFDSGRSGNILYYLFDMPYLNGVDLREVPVEERRVALSTVLNPN
KDPLLRFSDSFSEEPQALLNSACQMQMEGLIGKRLGTPYVSRRSSDWIKLKCKHRQEFVV
VGFTDPKGSRNAFGALLLGLHDRDSGELRYAGKVGTGFNETTLKRIYEQLKPLQTKKIPV
VNPPSGFDAKGVHWLKPTLLAEVAFAEMTKEGSVRHSVFHGLRDDKPAEDITEERPKAVK
TSAAKKTTAEKPSTPAKKKAAPAPSQIGLGEGKVRITHPDRVIDASSGATKVQLAEYYAS
VAEWILPELKDRPVALVRAPDGIAGELFFQKNAERLAIPGITTLDKALTGQPVMIINNAE
ALIGAVQMSTVELHTWNATSDNLDKPDRFVLDLDPDPALPWKSMVEATQLTLSVLDELGL
KAFLKTSGGKGIHLVVPLTRKLGWDEVKDFSHAIVSHMAKLLPERFSAVSGPKNRVGRIF
IDYLRNGLGATTICAYAVRAREGLPVSVPIFREEVGELKGGNQWNIHTVHERLAEVGGEP
WKDLKKTRQSITAEMRRRVGMKK
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggagcctggacgattacaatcgcatgcgcgatttttcggcaacctctgaaccg
gctgccggcaaacgttcgggcaagaaaaccgcgaaagaccatgcgttgcagttctgcatc
cagaagcacgacgcctcgcgcctgcattacgactttcgcctggaactcgatggcgcgctg
aaaagctgggcggtgcccaaaggcccgtcactggaccccaaggtcaagcgcctggcggtg
cacgtcgaagaccatccgattgattacgccaccttcgagggcagcattcccgaagggcat
tatggtgccggcgacgtgattgtctgggaccggggagtctggattcctcaggacgatccg
gccgaggcatacgccaagggcaagctcaaattcgagctaaagggcgagaagcttggaggg
ctgtggaacctggtgcgcacgcacatgccaggcaagcaggagcaatggtttctgatcaag
catcaggatggcgcggccaggcccgaaagcgattacgacgtggtcgccgccgagcccgac
agcgtgctcagtgaccggaccatcgttgccaaaaagccgaagactgctgccaaacccaag
cccgtcaaaaaacctgccagcccggcgcgcaacgaaaaatcggctcccttgacgggcgcc
cgcaaagccaaattgccggagatgctcaagccgcaactggcgacgctggtcgaaaaggcc
ccgggcggcgagtggagctatgagatcaagttcgatggctatcggatcatggcccgcatc
gaccacgacgaggtcaaactgttcacccgcaacggccacgactggacccataaactgccc
aggcaagccgaggcgttggcggcgctgggtctcgaatcggcctggctcgacggggaaatg
gtggtcgccaacgagcagggtgtgccggatttccaggccttgcaaaacgccttcgactcg
ggccgcagcggcaacatcctctattacctgttcgacatgccttacctcaacggtgtggac
ctgcgcgaggtgccggtcgaggagcgaagggttgcactgtcgaccgtgctcaaccccaat
aaagatccgctgctgcgcttctccgattcctttagcgaagaaccgcaagcgttgctcaac
agcgcctgccaaatgcagatggaagggctgatcggcaaacgcctgggcacgccttacgtg
tcgcggcgcagcagcgactggatcaagctcaagtgcaagcatcgacaggaatttgtggtg
gtcggcttcaccgatccgaaaggctcgcgcaatgccttcggtgcgctgctgctggggttg
catgaccgcgatagcggtgagttgcgttacgcggggaaggtcggcaccgggtttaacgag
acgacgctcaagcgcatttatgagcaactgaaaccgttgcagacgaaaaagatcccagtg
gtcaatccgccgagcggttttgacgccaagggtgtgcactggctcaagccgacactgctg
gcggaggtcgcttttgccgaaatgaccaaagaaggttcagtccgtcattcggtgttccat
ggtctgcgtgacgacaaacctgccgaagacattaccgaggagcgtccgaaagccgtgaag
acttcagccgcgaaaaagaccactgccgaaaaaccttccacccctgccaaaaagaaagcc
gcgcccgcaccctcacaaatcggcctgggcgagggcaaggtgcgcatcactcaccccgac
cgggtgatcgacgccagcagcggcgccactaaagtgcaactggcggagtattacgccagc
gtcgccgagtggattttgcctgaactcaaggatcgccccgtggcgttggtgcgtgcgccg
gacggcattgccggcgaactgtttttccagaagaacgccgagcgcctggccattccggga
attaccactctggacaaggcactcaccgggcaaccggtgatgatcatcaacaacgccgaa
gccctgatcggcgccgtgcagatgagcactgttgagttgcacacctggaacgccacctcg
gacaacctcgacaaacccgaccgcttcgtcctcgacctcgacccggacccggcgctgccc
tggaaaagcatggtcgaggcgactcaactgaccctctcggtgctcgatgaactggggctc
aaggcgtttctcaagaccagcggcggcaagggcattcacttggtggtgccactgacgcgc
aagctgggttgggatgaggtgaaagacttcagccacgcaatcgtcagccacatggccaag
ttgctgccggagcgtttttccgcggtgtcgggcccaaagaaccgggtcgggcggatcttc
atcgattacctgcgcaatggcctcggggccacgaccatctgcgcttacgccgtgcgcgcc
cgcgaagggctgccggtgtcggtgccgatctttcgcgaagaggtgggcgagctcaagggg
ggcaatcagtggaacatccacacagtgcatgaacgcttggccgaggtcggcggtgagccc
tggaaggatttgaagaaaacccggcaatcgatcaccgccgagatgcggcggcgggtcggg
atgaaaaaatag

DBGET integrated database retrieval system