KEGG   Pseudomonas frederiksbergensis: PFAS1_06985Help
Entry
PFAS1_06985       CDS       T04786                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00970  Aminoacyl-tRNA biosynthesis
pfk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFAS1_06985
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pfk03029]
    PFAS1_06985
Enzymes [BR:pfk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PFAS1_06985
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PFAS1_06985
Mitochondrial biogenesis [BR:pfk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PFAS1_06985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase RunxI
Motif
Other DBs
NCBI-ProteinID: APV39100
UniProt: A0A1P8ES96
LinkDB All DBs
Position
1449567..1451018
Genome map
AA seq 483 aa AA seqDB search
MHQLTLAEIARGLADKKFSSEELTKTLLARIAQLDPQLNSFISLTEDLALQQAKAADARR
ANGESGALLGAPIAHKDLFCTQGIRTSCGSKMLDNFKAPYDATVVAKLAAAGAVTLGKTN
MDEFAMGSANESSYYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPAATATDTGGSIRQPA
AFTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCAILLQGMAGFDPQDSTSIDE
PVPDYSAGLNGSLQGLRIGVPKEYFSAGLDPRIADLVMASVEELKKLGAVVKEISLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCEDPKNLEDLYKRSRGEGFGPEVQRRIMVGA
YALSAGYYDAYYLKAQKIRRLVKNDFMAAFNEVDIILGPTTPNPAWKLGAKSSDPVAAYL
EDVYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHQYQLNTDWHTRTP
TGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattgactctggccgagatcgcccgcggtctcgccgataaaaagttttcttcc
gaagagctgaccaaaaccctgctggcgcgtatcgcccagctcgatccgcagctcaacagt
ttcatcagcctcaccgaagacctggcgctccagcaggcgaaagccgctgatgcacgccgg
gccaatggtgagagcggtgccctgctcggtgcgccgattgcccacaaagacctgttctgc
acccagggcatccgcaccagctgcggctcgaagatgctcgacaacttcaaagcaccgtac
gacgccactgtcgttgccaagttggccgccgcgggtgccgtgacgctgggcaagaccaac
atggacgaattcgccatgggttcggccaacgagtcgagctactacggcgcagtgaaaaac
ccgtggaacctggaacacgtgcccggcggttcgtccggtggctcggccgcggccgtggcc
gctcgcctgttgccggccgccacggcgaccgacaccggcggctcgatccgccagcccgcc
gcgtttaccaacctgaccggtctgaaaccgacatacggtcgcgtttcgcgctggggcatg
atcgcctacgcgtccagtctcgatcagggcggcccgttggcacgcacggccgaagactgc
gcgatcctgctgcaaggcatggccggtttcgacccgcaagactccaccagcatcgatgag
cccgtgccggattacagcgccggcctcaacggttcgctgcaaggcctgcgcatcggcgtt
cctaaagagtatttcagcgcaggactcgacccgcgcattgccgacctggtcatggccagt
gtcgaagagctgaaaaagctcggtgccgtggtcaaggaaatcagcctgccgaacatgcaa
cacgcgatccctgcgtactacgtgatcgccccggcggaagcatcttccaacctgtcgcgt
ttcgacggtgtgcgtttcggttatcgctgcgaagacccgaaaaatctggaagacctgtac
aagcgttcccgtggcgaaggtttcggcccggaagtgcagcgccggatcatggtcggcgcc
tacgcgttgtccgctggctactacgatgcttactacctgaaggcgcagaagattcgccgc
ctggtgaagaacgacttcatggcggccttcaacgaggtcgacatcatcctcggcccaacc
acgccaaacccggcctggaagcttggcgccaaaagcagcgacccggttgctgcgtacctg
gaagacgtctacaccatcaccgccaacctcgccggcctgccgggcttgtccatgccagcc
ggttttgtcgatggtctgccggtcggcgtgcaattgctcgccccgtacttccaggaaggc
cgtttgctcaacgttgcgcaccagtatcagttgaacactgactggcacacccgcacccca
accggcttctga

DBGET integrated database retrieval system