KEGG   Pseudomonas frederiksbergensis: PFAS1_09140Help
Entry
PFAS1_09140       CDS       T04786                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00550  Peptidoglycan biosynthesis
pfk01100  Metabolic pathways
pfk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFAS1_09140
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PFAS1_09140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pfk01003]
    PFAS1_09140
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfk01011]
    PFAS1_09140
Enzymes [BR:pfk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PFAS1_09140
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PFAS1_09140
Glycosyltransferases [BR:pfk01003]
 Polysaccharide
  Bacterial polysaccharide
   PFAS1_09140
Peptidoglycan biosynthesis and degradation proteins [BR:pfk01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   PFAS1_09140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: APV39501
UniProt: A0A1P8ETD6
LinkDB All DBs
Position
1969578..1972022
Genome map
AA seq 814 aa AA seqDB search
MIRLLKFFGWSIVAVFCGLLLGLSGAFLYLSPGLPSVEALRSIQLQIPLRVYSSDNKLIA
EFGEMRRTPIRFADIPPNFINALLSAEDDNFANHYGVDPGSLMRAATQLIKSGHIQSGGS
TITMQVAKNFFLTSERSFSRKTTEILLALQIERQLTKDEILELYVNKIYLGNRAYGIEAA
AQVYYGKSIRDVSLAQMAMIAGLPKAPSRFNPLANPARSKERRDWILGRMYKLGKITEAD
YTTAINEPLNASYHVPTPEVNAPYIAEMARAEMVGRYGSDAYTEGFRVTTTVPSNLQEMA
NTALHEGLMTYDQRHGYRGPESRLPGKTREAWTTELTKQRTISSLEPAIVTQVDKTGLQV
LTRTGEEHVSWDTMKWARPFLNTNSMGANPKQPSDVAQVGDLIRVQRQPDNSLKFSQIPQ
VQGALVSLDPQNGAIRSLVGGFAFEQSNYNRAMQAKRQPGSSFKPFVYSAALDNGYTAAS
LVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIRMREALYKSRNLVSIRLLQALGVDRTIDY
ISKFGFNKQDLPRNLSLALGTATLTPMEIATGWSTFANGGYKITPYIIDKIESRNGDTLF
VANPPSVPKGNVVTDGIAAPVAANAFTVSATPGEALTAQPAPQTPAVAERIVDGRTTYIL
NSMLEDVIKLGTGRRALALGRSDIAGKTGTTNESKDAWFSGYNADYVTTVWTGFDQPESL
GRKEFGGTVALPIWMSYMGAALKDLPPHTQPEPEGILSLRVDPISGRAASPGTPGAYFEL
FKAEDTPPSANELGNGIAPGSPLPADEAAPIDLF
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgtctgctgaaatttttcggttggtccatcgtcgccgttttctgcggactgctc
ctcggtcttagcggcgcctttctctaccttagtccgggattaccatccgtggaggctctg
agaagcatccagttgcagattcctttgcgggtctacagcagcgacaacaagctgatcgca
gaatttggcgaaatgcgccgcacaccgatccggttcgccgacattccgcccaatttcatt
aatgcgttactaagtgctgaagacgacaacttcgccaatcattacggtgtcgatcctggc
agcctgatgcgcgcggccacccaattgataaaaagcggacacattcagtccggcggcagc
actatcaccatgcaggtggcgaagaatttcttcctgaccagcgaacgcagcttctcgcgc
aaaaccactgaaattctcctggccctgcagattgaacggcagttgaccaaggacgagatt
ctcgagttgtacgtcaacaagatctatctgggcaaccgtgcttatggcatcgaggccgcc
gcgcaggtttactacggcaagtcgattcgtgatgtcagcctggcgcagatggcgatgatc
gccggtctgccgaaagccccttcgcgcttcaacccgctggccaatccggcccgcagcaag
gagcgtcgcgactggatccttgggcgcatgtacaagctcggcaaaatcaccgaagccgac
tacacgaccgcgatcaacgagccgctgaacgccagctatcacgtgccgaccccggaagtg
aacgcaccgtacatcgctgaaatggcccgcgccgaaatggtcggccggtatggcagcgac
gcctataccgagggtttccgcgtcaccaccacggtgccgagcaacctgcaggaaatggcc
aacaccgccctccatgaagggttgatgacctacgaccagcgccatggttatcgcggaccg
gagtcgcgcctgccgggcaagactcgcgaggcctggacaaccgagctgaccaagcaacgc
accatcagcagccttgagcccgccatcgtcacccaggtcgacaagaccggcctgcaagtg
ctgacccgtaccggtgaggaacatgtcagctgggacaccatgaaatgggcgcggccgttc
ctcaacaccaacagcatgggcgccaacccgaaacagccttcggacgtcgcccaggtcggc
gacctgattcgtgtgcagcgccagccagacaactcgctgaaattcagccagatcccacag
gttcagggcgccctggtttccctcgatccgcagaacggtgcgattcgttccctggtcggc
ggcttcgccttcgaacagagcaactacaaccgcgccatgcaggccaagcgccagccgggc
tcgagcttcaagccgttcgtctacagtgcggcgctggataacggctacaccgccgccagc
ctggtgaatgacgcgccgatcgtgttcgtcgacgagtacctggacaaagtctggcgccca
aagaacgacaccaacaccttcctcggcccgatccgcatgcgcgaggcgctctacaagtcg
cgcaacctggtgtcgatccgcttgctgcaagcgctgggcgttgaccgcaccatcgactac
atcagcaagttcggcttcaacaagcaggacctgccacgcaacctgtccctggccctcggc
accgcgacgctgacgcccatggaaatcgccacaggctggagcactttcgccaacggcggc
tacaagatcaccccctacatcatcgacaagatcgaaagccgcaatggcgacacgctgttc
gtcgccaacccgccgagcgtccccaaaggcaacgtcgtcaccgacggtatcgctgcccct
gtcgcggccaacgccttcaccgtcagcgccacccccggcgaagcgctgaccgcacagcca
gcaccacaaacgccggccgtggccgagcgcatcgtcgatggccgcaccacttacatcctc
aacagcatgctcgaggacgtcatcaaactcggcaccggccgccgcgccctggccttgggc
cgtagcgacattgcgggcaagaccggtaccaccaacgagtccaaggacgcctggttctcc
gggtataacgccgattatgtgaccacggtctggaccggtttcgaccagcctgaaagcctg
ggtcgcaaggagttcggcggcaccgtcgccctgccgatctggatgagttacatgggcgcc
gcactcaaagacctgccgccccacacgcagccggagccggaaggcatcctcagcctgcga
gtcgacccgatcagcggccgtgcagccagcccaggcacgccaggtgcctacttcgagctg
ttcaaggccgaagatacgccaccgtcggcaaacgagctgggcaacggtattgcaccggga
agcccactgccagcggatgaagcggcgccgatcgatttgttctga

DBGET integrated database retrieval system