KEGG   Pseudomonas frederiksbergensis: PFAS1_11540Help
Entry
PFAS1_11540       CDS       T04786                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00010  Glycolysis / Gluconeogenesis
pfk01100  Metabolic pathways
pfk01110  Biosynthesis of secondary metabolites
pfk01120  Microbial metabolism in diverse environments
pfk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFAS1_11540
Enzymes [BR:pfk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PFAS1_11540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: APV39948
UniProt: A0A1P8EUM5
LinkDB All DBs
Position
complement(2512587..2513486)
Genome map
AA seq 299 aa AA seqDB search
MSTPNVEAVKLDELNCWRIRHGQAELLVAQQGAHILSYQVAGEPPLIWLNDEAVFKTGKS
IRAGVPVCWPWFGNLSRNPQSVQAMRVGNEAPTAHGFVRTMDWELGGIETEGESLKVEFL
LPYPEDGFPGWPHQVDLKLSIRLDEQLHISLTSHNQGADSVTISQALHSYFAVSDVREVH
VEGLDGLSYIETLDDWKAVTQTGDLRFAGETDRIYLNTPAKLSIIDPAWERRIELTSSGS
RSAVIWNPWIERAAAFSDMADDGWQRMLCIETANVMDDVVTLAPGASHTLGVNIGSKPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccaacgttgaagccgtgaaactggatgaactgaactgctggcgcatccgc
cacggtcaggccgaattgctggttgcccagcagggcgcacacatcctcagttatcaagtg
gccggggaaccgccgttgatctggctcaacgacgaggccgtgttcaagactggcaagagc
atccgcgccggggttccggtgtgctggccgtggttcggcaatctgtcgcgcaacccgcag
agcgttcaggccatgcgcgtcggcaacgaagcgccaaccgcccacggttttgtccggaca
atggactgggaactgggcggcatcgaaaccgaaggcgaaagcctgaaggtggaattcctt
ctgccctaccccgaagacggcttcccgggctggccgcatcaggtggatttgaagctgagc
atccgtctggacgagcaactgcatatcagcctgaccagccataaccagggtgctgacagc
gtcaccatcagccaggcgctgcacagctatttcgcggtcagcgatgtacgcgaagtacat
gtcgaagggctggatggcttgagttacatcgaaaccctggacgactggaaagccgtcact
cagaccggcgatctgcgttttgccggcgagaccgaccgtatctacctcaatacccctgcg
aagctgagcattatcgatccggcctgggaacggcgcatcgagctgaccagcagcggttca
cgctcggcggtgatctggaatccgtggattgaacgcgccgcagcgttcagtgacatggcc
gatgatggctggcagcgcatgctgtgcattgaaacggcgaacgtgatggatgatgtggtg
acgctggcgccgggtgcgagtcataccctgggtgtcaacatcggcagcaaacccctgtaa

DBGET integrated database retrieval system