KEGG   Pseudomonas frederiksbergensis: PFAS1_16645Help
Entry
PFAS1_16645       CDS       T04786                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00473  D-Alanine metabolism
pfk00550  Peptidoglycan biosynthesis
pfk01100  Metabolic pathways
pfk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PFAS1_16645
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PFAS1_16645
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PFAS1_16645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pfk01011]
    PFAS1_16645
Enzymes [BR:pfk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PFAS1_16645
Peptidoglycan biosynthesis and degradation proteins [BR:pfk01011]
 Precursor biosynthesis
  Amino acid ligase
   PFAS1_16645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 GARS_A ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: APV40894
UniProt: A0A1P8EXG1
LinkDB All DBs
Position
3587222..3588178
Genome map
AA seq 318 aa AA seqDB search
MTAAYANLVSTVAPKDFGRVAVLFGGKSAEREVSLKSGNAVLDALLSAGVDAFGLDVGDD
LLQRLLNEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLSCEADCISAATELGFPLIVKPAHEGSSIGMAKVTSTSELIDAWKAAST
YDSQVLVEQWIQGPEFTIATLRDQVLPPIALGTTHSFYDYDAKYVACDTQYRIPCGLDSN
KEKELMDLTAKACEALGIAGWGRADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAASIEPRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgcttacgccaacctcgtctccactgtcgcgccgaaagatttcggccgcgtc
gccgtgctcttcggcggcaagagtgccgagcgtgaggtttccctcaagtcgggtaacgcg
gttctcgatgcgctgctaagcgccggtgtggacgcgtttggtctcgacgtgggcgatgat
ctgttgcagcgtctgctgaacgaaaaaatcgatcgcgccttcatcattctccacggtcgt
ggtggtgaagacggcagcatgcagggcctgctggaatgcctgggtattccgtacaccggc
agcggcattcttgcttcggcgctggccatggacaagctgcggaccaaacaggtctggcac
agcctcggtattccgacgccacgccatgccgtactgagctgcgaggccgattgtatttcg
gcggcgacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagtatc
gggatggccaaagtgacctccacgtcggagttgatcgacgcgtggaaagcggccagtacc
tacgattcgcaagtgttggtcgagcaatggattcaaggtccggagttcaccatcgccacc
ctgcgtgaccaggtgttgccaccgattgccctgggcacgacgcacagcttctacgactac
gacgccaagtacgtggcttgcgatacccagtatcggattccgtgtggcctggacagcaac
aaagaaaaagaactgatggacctcacggcgaaagcctgtgaggcgctgggtatcgccggt
tggggcagggcagacgtgatgcaggacgccgacgggcagttctggttcctggaagtcaat
accgcgccgggcatgaccgatcacagtctggtgccgatggcggctcgtgctgccggtctg
gatttccagcaactggttctggcgattctggccgcaagcattgagccgcgaggttaa

DBGET integrated database retrieval system