KEGG   Pseudomonas frederiksbergensis: PFAS1_25290Help
Entry
PFAS1_25290       CDS       T04786                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pfk  Pseudomonas frederiksbergensis
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFAS1_25290
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PFAS1_25290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 K_oxygenase AlaDh_PNT_C FAD_binding_3 NAD_binding_8 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: APV42461
UniProt: A0A1P8F1W8
LinkDB All DBs
Position
5367180..5368742
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIIASLDDGAKSQEMLALLEDVASLSSQITLLDNGDDAR
KPSFSINRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRSLKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDDRQIMAVPSVYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKEAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADKLLPGKNGEL
HEVHFASGATLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVLGDGQ
KVNGLRYKDRQSDESRTVELEGIFVQIGLLPNTDWLKGTIELSPRGEIIVDARGETSMPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaagtcgtacctggaacgggtcacccagccg
atcgagatcatcgcctccctcgacgacggtgcgaaatcccaggaaatgctcgctcttctg
gaagacgttgccagtctttccagtcaaattaccttgctcgataacggtgacgatgcacgt
aaaccatcgttctcgatcaaccgtccgggtgccgatatcagcctgcgtttcgccggcatc
ccgatgggtcacgaattcacatccctggtgctggccttgctgcaagtcggcggtcaccct
tcgaaagccagcgttgaagtgatcgaacagattcgctcgctcaaaggcgagttcagcttc
gagacttacttctcgctgtcctgccagaactgcccggacgtggtccaggcactgaacctg
atggccgtgctgaacccgaacatccgccacgtcgccattgacggcgcgctgttccaggct
gaagtcgatgaccgtcagatcatggccgtgccaagcgtttacctgaacggcgtgaacttt
ggccagggtcgtatgggcctggaagaaattctcgccaagatcgacaccagcggcatcgag
cgtcaggccgagaaaatcagtgccaaagaagcctttgacgtgctggtcgtcggcggtggc
ccggccggtgcttccgccgcgatctacgctgcccgcaaaggcattcgtaccggtgtggcg
gctgaacgttttggtgggcaggtgctcgacaccatggccatcgagaacttcatctccgtg
caggaaaccgaagggccgaaactggctgtggcgttggaagaacacgtcaagcaatacgac
gtcgacatcatgaacctgcaacgcgccgacaagttgctgccgggcaaaaatggtgagttg
cacgaagtccacttcgccagcggcgcgaccctgaaagccaagaccgtgatcctggcgacc
ggtgcgcggtggcgtgaaatgaacgtcccgggagagcagcaataccgcaacaaaggcgtg
gcgtactgcccgcactgcgacggtccgttgttcaaaggcaagcgcgtggcggtgattggt
ggcggtaactccggcgtcgaagccgctatcgacctggcgggcatcgtgtcccacgtaacg
ctgctggagttcgacgtgcaactgcgcgccgatgcggtcttgcagcgcaagttgcacagc
ttgccgaacgtcaccgtgatcaccagtgcgcaaaccactgaagtgttgggcgacggccag
aaggtcaacggcttgcgttacaaggatcgtcagtcggacgagtcgcgtaccgtcgagctg
gaagggatcttcgtgcagatcggtttgttgcccaacaccgactggctcaaaggcaccatc
gagttgtcgcctcgcggcgagatcatcgtcgatgcccgcggtgaaacgtcgatgccgggc
gtgttcgctgccggtgacgtgaccaccgtgccgtacaagcagatcgtgattgcagtgggc
gagggcgcaaaggcttccctgagcgcattcgatcacctgatccggacctcggctccggca
taa

DBGET integrated database retrieval system