KEGG   Pseudomonas frederiksbergensis: PFAS1_25685Help
Entry
PFAS1_25685       CDS       T04786                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00500  Starch and sucrose metabolism
pfk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFAS1_25685
Enzymes [BR:pfk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PFAS1_25685
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PFAS1_25685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: APV42535
UniProt: A0A1P8F238
LinkDB All DBs
Position
5470362..5473703
Genome map
AA seq 1113 aa AA seqDB search
MAKKPKAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTMADAKRFISEAHKRGLRVITELVINHTSDQHA
WFQRARKAKKGSAARDFYVWSDDDHKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGDTDAKGLNGDECHMAFHFPLMPRMYMALAQEDR
FPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRR
RLAPLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRN
GGFSRADPASLVLPPIMDPQYGYLSVNVETQAGDPHSLLNWTRRMLAVRKQSKAFGRGTL
KMLSPTNRRILAYTREFTGPDGKHEIILCVANVSRSAQAAELDLSAYVGMVPVEMLGGNA
FPPIGQLNFLLTLAPYGFYWFVLAAENQMPSWHVEPAQSLPDFTTLVLKKRMEELLEAPS
RDTLEQGILPSWLQNRRWFAGKDAAIEQVNIAYGVRFGDPLHPVLLSEIDVTSGGQTSRY
QLPFGFISEDQVGAALPQQLALSRVRRVRQVGLITDAFSLDTFVHAVLQGMQSNTVVPSS
AGDICFEPTWELAKLGLTGESEVRYLSAEQSNSSVVIGNSLVLKLIRKIASGVHPELEMS
AYLTHAGFRNISPLLGSVVRRDPAGEETLLMIAQGYLSNQGDAWEWTQNNLERALRDELA
DAMSEQEQHYNALGELRDFAGMLGQRLGEMHQVLAAPSDNPDFTPQVTTQKDALASAKDV
AGQLEYALKLLKQHQIELNPADKALVTHLLDNKKAILSHVQELGKKAVGGLRIRVHGDLH
LGQVLVIKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMAINVHNVDNT
ADAHAARQRVADRYLNEAKQAFVDAYRLAAASLAHAWQDPEGEDAALALFGLEKAAYEVA
YEAENRPTWLPVPLHGLYGLLSGLKPFSDLGGE
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaaggctgccacctttatcaaggacccgctctggtacaaggatgcg
gtgatctaccaggttcacgttaagtcttatttcgactccaacaatgacgggatcggcgac
tttcccggtcttatcgccaaactcgactacattgccgatctgggcgtcaacaccatctgg
ctgttgccgttctatccttcgccacggcgtgatgacggctacgacattgccgaataccgt
ggcgtgcattccgactacggcaccatggccgacgccaagcgtttcatttctgaagcccac
aaacgtggcttgcgggtgattaccgaactggtcatcaaccacacctcggaccagcacgcc
tggtttcagcgtgcgcgcaaggccaagaaaggctcggcggcacgggatttctacgtctgg
tccgatgacgatcataagtacgacggcacccgcatcatctttctcgacaccgagaagtcc
aactggacctgggacccggtggccggccagtacttctggcatcgcttctattcccaccag
ccagacctgaacttcgataacccgcaagtcatgaaagccgtgctgtcggtgatgcgctac
tggctggacatgggcatcgatggcttgcgtctggatgcgattccgtacctgatcgaacgc
gacggcaccaacaacgaaaacctgcccgagacccacgacgtcctcaagcagatccgtgcc
gaaattgacgccaactacccggaccgcatgctgctggccgaggccaaccaatggccggag
gacacgcaactgtacttcggcgacaccgacgccaaaggcctgaacggtgacgaatgccac
atggcgttccacttcccgctgatgccgcgcatgtacatggcgctggcccaggaagaccgt
tttccgatcaccgatatccttcgtcagactccggagatcccggccaactgccagtgggcg
attttcttgcgtaaccacgatgagctgacgctggaaatggtcaccgacaaggaacgcgat
tacctgtggaattactacgcggccgaccgtcgggcgcggatcaacctggggattcgccgc
cgcttggcgccgttgatggagcgcgatcgtcgtcgcgtggaactgctcaacagtttgctg
ctgtcgatgcccggcacgccgaccctgtattacggcgatgaaatcggcatgggcgacaac
atctacctcggcgaccgtgacggcgtgcgcacgccgatgcagtggtcgattgaccgtaac
ggcggtttctcccgcgccgacccggccagcctggtgctgccgccgatcatggacccgcaa
tatggttacttgtcggtcaacgtcgaaacccaggccggcgacccgcattcgttgctcaac
tggacccggcgcatgctcgccgtgcgcaagcagtccaaggccttcggtcgcggcaccctg
aagatgctttcgccgactaaccggcgaatcctggcctacacccgggaattcaccggaccg
gacggcaagcacgaaatcatcttgtgcgtcgccaacgtgtcccgcagcgcgcaagcagcg
gagctggacctgtcggcctacgtcggcatggtgccggtggagatgctcggcggtaacgcc
ttcccgcctattggccagttgaatttcctgctgaccctggcgccttacggcttctattgg
tttgtattggcggcggaaaaccagatgccgagctggcacgtggaaccggcgcaaagcctg
ccggacttcaccacgctggtgctgaagaaacgcatggaagaactgctcgaagcgccgtct
cgcgacacgctggagcagggcatcttgccgagctggctgcagaaccgccgctggtttgcc
ggcaaggacgcggccatcgaacaggtcaacatcgcttacggcgtgcgcttcggcgatccg
ctgcatcccgtattgctgagtgaaatcgatgtcaccagcggcggccagaccagccgctat
cagttaccgttcggttttatctctgaagatcaggtgggcgccgcgttgcctcagcaactg
gccttgtcgcgggtccggcgcgtgcgtcaggtcggcttgatcaccgatgccttcagcctc
gataccttcgtgcatgcggtgttgcagggcatgcaaagtaataccgtagtgccatccagt
gcgggcgatatctgctttgagccgacgtgggagctggcgaaactcggcctgaccggggaa
tccgaggtgcgttacctgtccgccgaacagtccaacagttcggtggtgatcggcaacagc
ctggtgctgaagctgattcgcaagatcgcgtccggcgtgcacccggaactggaaatgagc
gcgtacctgactcatgccggtttccgcaatatctcgccgctgctgggttcagtggttcgc
cgtgatccggcgggcgaggaaacgttgctgatgattgcccaaggctacttgagcaatcag
ggcgacgcctgggaatggacccagaacaacctcgaacgggcactgcgcgacgagttggcc
gacgccatgtccgagcaggagcaacattacaacgccttgggcgaactgagagacttcgcc
ggcatgctcggtcagcgcctgggtgaaatgcatcaggtgctggcggcgcccagcgacaac
ccggacttcaccccacaggtgaccacccagaaagatgccctggcctcggccaaggacgtg
gcggggcaactggagtacgcgctgaagttgctcaagcagcatcaaatcgaattgaacccg
gcagataaagccttggtcactcatttactggacaacaaaaaagccatcctcagccatgtt
caggagctgggcaaaaaagccgttggtggtctgcgcattcgcgtccacggcgacttgcac
ctgggccaggtgctggtgatcaagggtgacgcctacctgatcgacttcgaaggcgagccg
gcgcggccgctgcatgaacgacggggcaaacacagcccgtacaaagacgtcagtggggtg
ttgcgctcctttgactacgctgcggcgatggcgatcaatgtgcacaacgtcgataacacg
gccgatgcccatgccgcacgtcaacgtgtcgccgatcgctatttgaatgaagcaaaacaa
gcatttgtcgacgcttatcggctggcggcagctagtcttgctcatgcatggcaagatccg
gaaggcgaggacgccgctttggcgttgttcggcctggagaaggcagcgtatgaagtggcc
tatgaggcggaaaatcgccccacatggttgcccgtgccgttgcacggtttgtatgggtta
ttgagtgggcttaaacccttttccgatcttggtggagagtag

DBGET integrated database retrieval system