KEGG   Pseudomonas frederiksbergensis: PFAS1_28620
Entry
PFAS1_28620       CDS       T04786                                 

Definition
(GenBank) 3-(cis-5,6-dihydroxycyclohexa-1,3-dien-1-yl)propanoate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00624  Polycyclic aromatic hydrocarbon degradation
pfk00626  Naphthalene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
pfk01220  Degradation of aromatic compounds
Module
pfk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PFAS1_28620
   00624 Polycyclic aromatic hydrocarbon degradation
    PFAS1_28620
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     PFAS1_28620
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     PFAS1_28620
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase
Other DBs
NCBI-ProteinID: APV43290
UniProt: A0A1H4IB21
LinkDB
Position
unnamed:6473..7252
AA seq 259 aa
MGNQQVVSITGAGSGIGLELVRSFKSAGYYVSALVRNEEQEALLCKEFKDALEIVVGDVR
DHATNEKLIKQTIDRFGHLDCFIANAGIWDYMLSIEEPWEKISSSFDEIFDINVKSYFSG
ISAALPELKKTNGSVVMTASVSSHAVGGGGSCYIASKHAVLGMVKALAYELAPEVRVNAV
SPGGTVTSLCGPASAGFDKMHMKDMPGIDDMIKGLTPLGFAAKPEDVVAPYLLLASRKQG
KFITGTVISIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgggcaatcaacaagtcgtttcgataaccggtgcaggctcaggaatcggtctcgaactg
gttcggtcctttaagtcggccggttattacgtatccgctctcgtacgaaacgaggagcaa
gaggcgcttctttgcaaagagttcaaggacgcactcgagattgtagtgggcgatgtccgg
gaccacgcaacaaatgagaagctgataaagcaaacaatcgatagattcggtcatcttgat
tgttttattgcaaatgccggtatctgggattacatgctgagcatcgaagagccttgggag
aaaatatcgagcagttttgacgaaatattcgacattaatgtcaagagctatttcagtggc
atcagtgccgccctgccggaactgaaaaagactaacggatcagtggtgatgaccgcttcg
gtgtcgtcccatgcggtcggtggtggtggttcttgctacatcgccagcaagcatgcggtg
ctcggtatggttaaggctttggcctacgaattggcccccgaagttcgcgtgaacgctgtt
tcgccggggggcaccgtgacgtctctgtgcggtcccgcgagcgccggtttcgacaaaatg
cacatgaaagacatgcccggcatcgacgatatgatcaaaggtctcacgcctcttgggttt
gcagccaagcccgaagacgtggtggcaccctatttgttgctggcttcgcgaaagcaagga
aaattcatcaccggcaccgtgattagcattgatggcggtatggcgctcggtcgcaagtga

DBGET integrated database retrieval system