KEGG   Pseudomonas frederiksbergensis: PFAS1_28625
Entry
PFAS1_28625       CDS       T04786                                 

Definition
(GenBank) dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00626  Naphthalene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
pfk01220  Degradation of aromatic compounds
Module
pfk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PFAS1_28625
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     PFAS1_28625
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: APV43291
UniProt: A0A1H4ID85
LinkDB
Position
unnamed:7299..8750
AA seq 483 aa
MKTKLFINNAWIDSSDQQTFERIHPVSSDVVTESANATVTDAIKAAQAAEEAFKTWKAVG
PSERRRLLLKVADVMESKTPKFIEVMAMEVGASALWAGFNVHASANVFREAASLATQIQG
ETIPTDKAETLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLIVDEKIADEF
VAKFVEKTKRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGLAQGAL
MPATILDHVKSDMRIYDEETFGPITVVIRCKGEAEAVRIANDSVYGLSSGVFGRDINRAL
RVGMSIEYGSVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTEIKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaagacaaaactgtttatcaataacgcctggatcgattctagtgaccagcagaccttc
gagcgcatacaccccgtcagcagcgatgtggtgactgagagcgcaaacgccacagtgacg
gacgcgataaaggcggcgcaagcggccgaggaggcgttcaagacctggaaggccgttgga
ccttcagagcgtcgccgccttctcctaaaggtcgccgatgtcatggaaagtaaaacaccc
aagttcatcgaagtgatggccatggaggtgggagcttccgccctttgggccggattcaac
gtccatgcgtctgccaatgtgttccgagaggctgcctcgctggctacccaaattcagggt
gaaaccatcccaacggacaaagccgaaacgctctcaatgacactacgtcagccggtcggc
ccgatcctaagcatcgttccatggaacggcaccgcagtgcttgcggcacgagccatcgct
tatccgctggtctgtggcaacactgtggtgttcaaaggctctgaatttagtcccgcgacg
catgccctgatcacccagtgcgtgcaggaagccgggctgcccgctggcgtgctcaattac
ctcaactcttcgcctgaccgttcgcccgagatcgctgacgcactgatctctgccaaggag
atccgccgcatcaacttcacgggttccacccgcgtgggcagcattatcgcgcagaaagcc
gcgcaacacctcaagcgctgcctgctggagctcggcggcaagtccccgcttattgttctg
gatgatgcagacatcgatgcggcggtcaaggcagcggtgttcggtagcttcctgttccaa
ggtcagatctgcatgtccactgagcgcttgatcgttgatgagaagatagccgacgaattt
gtcgcaaaatttgtcgaaaaaactaagcgcttgagcgcaggcgacccgtgcgtaactggc
gactgcatcatcggcccgatggtctcgccaaattcgggtgagcggatcaatggtttgttc
aaagacgcgatcgacaaaggggcaaaagttgtttgcggcggcttggcccaaggtgcgctc
atgccggccacgatcctggatcacgtcaaatctgacatgcggatttacgatgaggagacc
tttggtcccatcaccgtggtaatccgttgtaaaggcgaagcagaggccgtccgcattgcc
aacgacagcgtctatggcctgtcgtcgggcgtatttggccgcgacatcaaccgcgctcta
cgcgtgggtatgtccatcgaatatggttctgtacacatcaacggttcgaccgtccagaac
gaggcgcaggctccttacggaggcaccaagaacaccggctacgggcgcttcgacggccgt
gctgtaatcgacgagttcacagagatcaagtggctgaccatcgaacctttcgagcagcaa
tatcccttctga

DBGET integrated database retrieval system