KEGG   Pseudomonas frederiksbergensis: PFAS1_28630
Entry
PFAS1_28630       CDS       T04786                                 

Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00626  Naphthalene degradation
pfk01100  Metabolic pathways
pfk01120  Microbial metabolism in diverse environments
pfk01220  Degradation of aromatic compounds
Module
pfk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PFAS1_28630
Enzymes [BR:pfk01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     PFAS1_28630
SSDB
Motif
Pfam: Glyoxalase YdiH
Other DBs
NCBI-ProteinID: APV43292
UniProt: A0A1H4IBZ0
LinkDB
Position
unnamed:8778..9686
AA seq 302 aa
MSKQAAVIELGYMGISVKDPDAWKSFATDMLGLQVLDEGEKDRFYLRMDYWHHRIVVHHN
GQDDLEYLGWRVAGKPEFEALGQKLIDAGYKIRICDKVEAQERMVLGLMKTEDPGGNPTE
IFWGPRIDMSNPFHPGRPLHGKFVTGDQGLGHCIVRQTDVAEAHKFYSLLGFRGDVEYRI
PLPNGMTAELSFMHCNARDHSIAFGAMPAAKRLNHLMLEYTHMEDLGYTHQQFVKNEIDI
ALQLGIHANDKALTFYGATPSGWLIEPGWRGATAIDEAEYYVGDIFGHGVEATGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagtaagcaagctgcagttatcgagctcggatacatgggtatctcggtcaaggaccct
gatgcgtggaaatcatttgccacggatatgctaggtctgcaagttcttgatgagggtgag
aaggaccgtttctatctgcggatggattactggcatcatcggatcgtagtccatcacaac
ggacaggacgacttggagtacctaggctggcgtgtagccggcaagccggagttcgaagct
ctgggtcaaaagcttattgatgccggttacaagatccgcatctgcgacaaagttgaggct
caggagcgtatggtgttgggtctgatgaagacagaagatccgggcggcaacccgaccgag
atattctggggcccccggatcgacatgagcaacccgttccatcccggtcgccccctgcac
ggaaagtttgtgaccggtgaccaaggcttgggccattgcatcgttcgccaaaccgacgtc
gcagaagctcataagttttatagcctgctgggcttccgtggggacgtcgaataccggatt
ccgttgcccaacggcatgactgccgaactgtcgttcatgcattgcaacgcccgtgatcac
tccattgcttttggtgccatgcccgctgccaaacgactcaatcacttgatgcttgagtac
acccatatggaagacttgggatacacgcaccaacagtttgtaaagaacgaaattgacatt
gccttgcagcttggcattcacgccaacgacaaggcgttgacgttctatggtgcaacgcct
tcgggctggctcattgagcccggctggcgaggtgccacggccatagatgaagcggagtat
tacgtcggcgacatcttcggccatggcgtggaggccactggatatggcctggatgtaaaa
ctgagctaa

DBGET integrated database retrieval system