KEGG   Pseudomonas frederiksbergensis: PFAS1_28665Help
Entry
PFAS1_28665       CDS       T04786                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pfk  Pseudomonas frederiksbergensis
Pathway
pfk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pfk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PFAS1_28665
Enzymes [BR:pfk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PFAS1_28665
Transporters [BR:pfk02000]
 Other Transporters
  Pores ion channels [TC:1]
   PFAS1_28665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C_3 GST_C_2 GST_C GST_C_5 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: APV43296
UniProt: A0A1P8F4A5
LinkDB All DBs
Position
unnamed:15161..15778
Genome map
AA seq 205 aa AA seqDB search
MKLYYSPGACSLSPHIVLREGSFDFKLERVDLQSKQTETGSDYKTINPLGCVPALQLDDG
QVLTEGPAIVQYLADRVPEKRLAPSAGTLEHYRLMEWLNFISTELHKGFGALFNSALSDD
AKAVINSSLEQRIAHAEKRLGVGPYVMGNDFSVADAYLFTVLGWAKYVNVDLAPWPGLLD
YLSRVAPRPAVQAALAAEGLIPASK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattacagccccggcgcctgctcgctttcgccccacatcgtgcttcgcgag
ggcagtttcgactttaagctggagcgcgtggatctgcagagcaagcagaccgaaaccggc
tccgattacaaaaccatcaatcccttgggttgcgtcccggccttgcagctcgacgatggg
caggtgctcaccgaaggaccggccatcgtgcaatacctcgccgaccgcgtgccggaaaaa
cgcctggcgccgtcggcgggcacgctggaacattaccgcctgatggaatggctcaacttc
atttccacggagttgcacaagggcttcggcgcgctgtttaactcggcgctttccgatgac
gcgaaagcggtcatcaattcgtcgctcgaacaacgtatcgctcatgccgagaagcggctc
ggggtgggtccctatgtgatgggcaacgacttttccgtggcggacgcctacctcttcacc
gtgctggggtgggctaagtacgtgaatgtggacctcgcgccctggccgggactgctcgat
tatctcagccgcgtggcgccccgtcccgccgtccaggccgcgctcgcggcggaaggcctg
attcctgcatcgaaataa

DBGET integrated database retrieval system