KEGG   Pseudomonas protegens Pf-5: PFL_0767Help
Entry
PFL_0767          CDS       T00249                                 

Definition
(GenBank) putative membrane protein
  KO
K07090  uncharacterized protein
Organism
pfl  Pseudomonas protegens Pf-5
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PFL_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AAY96169
UniProt: Q4KIM9
LinkDB All DBs
Position
892952..893716
Genome map
AA seq 254 aa AA seqDB search
MNSSLAFYQNLGMALSLLVIGTFVLAGMVKGVIGLGLPTVAMGLLGLAMAPAQAAALLII
PATLTNLWQLAFGGHLPALLKRLWPMLLAIFAGTAAGSLWLGIDAGHWVVRGLGAALLLY
ALSGLLLPTLRVSAALERWLGPLCGLVTGVITSATGVFVIPAVPYLQALGLNKDQLVQAL
GLSFTVSTLALAGGLLWRGALGGAELGASLLTLAPALLGMWLGQWLRQRISAQLFKRVFF
VGMGLLGGHLLISG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacagctcgctcgcgttttatcagaatctcggaatggccctttccctgttggtgatc
ggcacttttgtgctggccggcatggtcaagggggtgatcggtcttggcctgcccaccgtt
gccatgggcctcttggggttggctatggcgccggcgcaggctgcggccctgctgattatc
ccggcgaccctgaccaatctctggcaactggcctttggcgggcatctgccggccttgctc
aagcgcctgtggccgatgctgctggcgatctttgccggcaccgccgccggctccctgtgg
ctgggaatcgacgccgggcattgggtggtgcggggcttgggggcggcgctactgctatat
gccctgagcggcttgctgttgccgaccctgcgagtgtcggcggccctggagcgctggctg
gggccgctgtgcgggctggtcaccggggtcatcacctcggccaccggggtgttcgtgatt
ccggcggtgccctacctgcaagccctggggctgaacaaggatcagctggtgcaggccctg
ggcctgtcgttcaccgtctcgaccctggccctggccggcggcctgctgtggcgcggcgcc
ctgggcggcgccgagctgggggcctcgctgctgaccctggccccggcgctgctgggcatg
tggctggggcagtggttgcgccagcgcatcagcgcccagttgttcaagcgggtgttcttt
gtcggcatgggcctcttgggcgggcacttgctgatcagcggctag

DBGET integrated database retrieval system