Pseudomonas protegens Pf-5: PFL_1645 Help Entry PFL_1645          CDS       T00249                                  Name (GenBank) HPt domain protein   KO K20976   histidine phosphotransfer protein HptB Organism pfl  Pseudomonas protegens Pf-5 Pathway pfl02020   Two-component system pfl02025   Biofilm formation - Pseudomonas aeruginosa Brite KEGG Orthology (KO) [BR:pfl00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     PFL_1645  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     PFL_1645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02022 Two-component system [BR:pfl02022]     PFL_1645 Two-component system [BR:pfl02022]  Other families   SagS-HptB-HsbR (swarming activity and biofilm formation)    PFL_1645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hpt Motif Other DBs NCBI-ProteinID:  AAY90942 UniProt:  Q4KG62 LinkDB All DBs Position 1848258..1848602 Genome browser AA seq 114 aa AA seqDB search MAEIHLDHTVLNALQEVMEDEYPVLLDTFVCDSEERVRLLHKSEDTILLVATAHSLKGSS SNMGATRLAELCHQLELRAGQSAADGIRQLVGEIDGEFAIVRRLCEQELQRFHC NT seq 345 nt NT seq  +upstreamnt  +downstreamnt gtggctgagattcatctggaccacacggtgctcaatgctttgcaagaggtcatggaggat gaatatcccgtcctgctggataccttcgtctgcgattccgaggagcgtgtgcggttgctg cataagtccgaggatacgattttgctggtagccaccgcccacagcctcaagggcagcagc agcaacatgggcgccacccgcctggccgaactctgtcatcagctggaactgcgggccggg cagtcggccgcggatggcattcgacaattggtgggggagatcgacggcgagttcgctatc gttcgacgcttgtgcgagcaggagctgcagcgctttcattgttga

DBGET integrated database retrieval system