KEGG   Pseudomonas protegens Pf-5: PFL_2677Help
Entry
PFL_2677          CDS       T00249                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pfl  Pseudomonas protegens Pf-5
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY91950
UniProt: Q4KD99
LinkDB All DBs
Position
complement(2956544..2956945)
Genome map
AA seq 133 aa AA seqDB search
MNPSPAIRQPCPPGACICEREQLLDTPGADLRILNLTRQEEKRLLERLENLKDLADLEHM
QRRMYEQLGIRVEISPSDNVVRSMRGIAISLGELPGLCRKTRQSIPAAIRRAMEQRPEIA
YRLLDSQDLLRGT
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccagccccgcgatccgccaaccctgtccgcccggcgcctgcatttgcgagcgc
gagcagttgctggacacccccggagccgacctgcgcatcctcaatctcacgcgccaggag
gaaaagcgcctgctcgaacgcctggaaaacctcaaggacctggcggacctggaacacatg
cagcggcggatgtacgaacaactgggcatccgcgttgagatcagccccagtgacaatgtg
gtccgcagcatgcgcggcatcgccatttccctgggcgagttgcccggcctgtgccgcaag
acccggcaatcgatcccggccgccatccgccgggccatggagcagcgcccggaaatcgcc
taccgcctgctggactcccaggacctgttgcgcggcacctga

DBGET integrated database retrieval system