KEGG   Pseudomonas protegens Pf-5: PFL_2768Help
Entry
PFL_2768          CDS       T00249                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00564  Glycerophospholipid metabolism
pfl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PFL_2768
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PFL_2768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AAY92040
UniProt: Q4KD09
LinkDB All DBs
Position
3073282..3074871
Genome map
AA seq 529 aa AA seqDB search
MSQDWNAQWRQEVLPGLATQAWDLIVIGGGISGAGILREAARRGWRCLLLEQRDFAWGTS
SRSSKMVHGGLRYIAKGQWRLTRDSVRERQRLLQEAPGLVEPMSFLMPHYRGKFPGPRVF
GGLLSVYDALAGRRNHRFYDARQLAFLAPGVKEPGLLGGTSFLDALTDDARLVMRVLAEA
RADGAQVFNGVRVTRLLRENGRVCGVQIEDSEGGQPQQVRCAVLAVATGAWAERLRPADR
VRQLRPLRGSHLLLPGWRLPVAQAFSFMHAEDGRPVFVFPWEGATVVGTTDLDHRDDLDQ
SASISQEELEYLLAACAQQFPQALITAGDVLSTWAGVRPVVASSDGQQGKPSNETREHVL
WQEPGCVTLAGGKLTTFRPQAIEVLQACGAMLGREVVDDGAPVFTPVAPLEIPGLSGAQV
RRLAGRHGRHLPRLAQWVATLGGDCVGASDTLWAELAFAAEAEMVLHLDDLLLRRTRIGL
LLAEGAAQYLPAIRRLCQPQLGWDDERWQAEEQRYRALWQRHHSLPPLA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggactggaatgcccagtggcgccaagaggtgctgcccgggctggcgacgcaa
gcctgggacctgatcgtgatcggtggcggcatcagcggcgccggcatcctgcgcgaagcg
gcgcggcgcggctggcgttgcctgctgctggaacagcgagactttgcctggggcacctcc
agccgctcctcgaagatggtccatggcggcttgcgctatatcgccaagggccagtggcgc
ctgacccgggattcggtgcgcgagcgccagcgcctgttgcaggaggccccggggctggtg
gagcccatgagcttcctgatgccccattaccgcggcaagtttcccgggcccagggtgttc
ggcggcctgctgagtgtgtatgacgccttggcggggcggcgcaatcatcgcttttacgat
gcccggcagctggctttcctggcccccggggtcaaggagccggggctgttgggggggacc
agttttctcgacgccctgaccgacgatgcgcggctggtgatgcgggtgctggccgaggcc
cgggccgatggcgcccaagtgttcaacggcgttcgggtcacccgccttttgcgcgagaac
gggcgggtctgcggggtgcagatcgaggacagcgaaggcgggcagccgcagcaggtgcgc
tgcgcggtcctggcggtcgctaccggcgcctgggccgagcgcctgcgcccggcggaccgc
gtgcgccaactgcggcccttgcgcggcagccatctgctgctgccgggctggcgcttgccg
gtggcccaggccttcagcttcatgcatgccgaggatggccggccggtgtttgtcttcccc
tgggagggcgccaccgtggtcggcaccaccgacctggatcaccgcgatgacctggaccag
agcgccagcatcagccaggaagagcttgagtacctgctggccgcctgcgcccagcagttt
ccccaggccctgatcactgccggcgacgtgctgtcgacctgggccggggtgcgcccggtg
gtggccagcagcgacggccagcagggcaagccttccaatgaaacccgcgagcatgtgctg
tggcaggaacccggctgcgtgaccctggccggcggcaagctcaccaccttccggccccag
gccatcgaagtgctgcaggcctgcggggcgatgctcgggcgtgaagtggtggacgacggc
gccccggtcttcacgcctgtggcgcccctggagatccccggtctgagcggcgcccaggtg
cggcgcctggctggccgccacggccgccatctgccgcggctggcgcagtgggtggcgacc
ctgggcggtgattgcgtcggcgccagcgacaccctgtgggccgaactggcgtttgccgcc
gaggcggaaatggtcctgcacctggacgacctgctgctacgccgcacccgcatcggcttg
ctgctggccgagggcgccgcccagtacctgccggccatccgccgcctgtgccagccgcag
ctgggctgggacgacgagcgctggcaggccgaggaacagcgctaccgggccctgtggcaa
cgccatcacagcctgccgccactcgcctaa

DBGET integrated database retrieval system