KEGG   Pseudomonas protegens Pf-5: PFL_3362Help
Entry
PFL_3362          CDS       T00249                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
pfl  Pseudomonas protegens Pf-5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AAY92631
UniProt: Q4KBB6
LinkDB All DBs
Position
complement(3882638..3883684)
Genome map
AA seq 348 aa AA seqDB search
MSPCALLETRHASTQAVDLDQRLAFWEDYNASTLVGLKCNSYAEGGFAASQDNLQLSAMR
LARIVGNEHVVERDTSMIRGVPKESIFVSLVTGSGSFFYQDGACQVLEPGELVVYRTDKP
YLFGFSGAMRQFIFDIPQQQFAERCLKRFDRPLRTSVESGVQRLLLRTLGERTRGFFQQP
LCAEAEAYQEQAFELLASIIAGHVGERPINALSASYLLAAKQCIHEQLADPTLSCERVAA
QTGISTRHLARLFALEETLPSRFILEKRLQQARQLLCSSQGAGLDISEIAYRHGFASQAH
FARAFKSRFQQTPSEARALGLAATLAIPAAESVGHACGDNLRGLEQGN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatgcgccttgctcgaaacccggcatgccagcacccaggccgtcgacctggac
caacgcctggccttctgggaggactacaacgccagcaccctggtggggctcaagtgcaac
tcctacgccgagggcggtttcgccgccagccaggacaacctgcaattgagcgccatgcgc
ctggcccgcatcgtcggcaacgaacacgtggtggagcgcgacacctcgatgatccgcggc
gttcccaaggagtcgatcttcgtgtccctggtcaccggcagcggctcgttcttctaccag
gatggcgcctgccaggtgctggagccgggggagctggtggtctaccgcaccgacaagccc
tatctgttcggcttttccggggccatgcgccagttcatcttcgacattccccagcagcag
ttcgccgaacgctgcctgaaacgcttcgaccggcctttgcggaccagcgtcgaaagcggg
gtccagcgcctgttgctgcgcaccctgggcgaacgtacccggggctttttccagcaaccc
ctgtgcgccgaggccgaggcttatcaggagcaggccttcgagcttctggccagcatcatt
gccgggcatgtgggggaacggccaatcaacgccctgagcgcctcctacctgctggcggcc
aagcaatgcatccatgaacagctggccgacccgaccctgagctgcgagcgggtggcggcc
cagaccggcatttccacccggcacctggcccggctgttcgccctggaagaaacgctaccc
agccgcttcatcctggaaaaacgcctgcaacaggcccgtcaactgctgtgcagcagccag
ggagcgggcctggatatcagcgagatcgcctaccggcacggctttgccagccaggcgcat
tttgcccgggccttcaagagccgcttccagcaaactcccagtgaggcacgcgccctgggg
ttagctgcaaccctggcaatcccggcagccgaaagcgtcggtcacgcctgtggcgacaat
ctccggggcctggagcaaggcaactga

DBGET integrated database retrieval system