KEGG   Pseudomonas protegens Pf-5: PFL_3364Help
Entry
PFL_3364          CDS       T00249                                 

Definition
(GenBank) transporter, major facilitator family
Organism
pfl  Pseudomonas protegens Pf-5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Nuc_H_symport MFS_1_like LacY_symp
Motif
Other DBs
NCBI-ProteinID: AAY92633
UniProt: Q4KBB4
LinkDB All DBs
Position
3884579..3885859
Genome map
AA seq 426 aa AA seqDB search
MAYKNNKAGYENTLLGVLFLTFGFVFFDRLALSFLFPFMADELQLSNSHLGMLSSILALA
WAVSGALVGAWSDRRGVRKPLLIVAVILFSLCSALSGLVTGFLSLLLFRAIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPVLIALAEAYGWRHAFIISLIPG
LLIALLIWRYVQPDPPRHEPRAHTPSSPGGSHRLALLKSRNIVLCTLISCVFLTWFIILI
SFTPTFLVKVRDYSPASMGTVMSCLGGAWVLWGFGVPAISDRLGRRPTLVLFSLIAACCP
IALLYASSPWMLGVLMLLTYTGLGCFTLFMATIPAETVPREVMATALGMIMGIGELVGGF
IAPTIAGFAADRFGLSIVMWMSCGGALLAAVLALFLKETAPAVLARQQRRHPGPNPAPSP
SLEGNP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcttataaaaacaacaaggccggttacgagaacaccttgctgggggtgctgttcctg
accttcggtttcgtctttttcgatcgtctggcgctgtccttcctgttccccttcatggct
gacgagttgcaactgagcaacagccacctgggcatgctgtcgtcgatcctggccctggcc
tgggcggtgtccggggccctggtgggtgcctggtcggaccgccggggcgtgcgcaagccg
ttgctgatcgtcgcggtgatcctgttttccctgtgctcggcgctgtccgggctggtcacc
ggctttctcagccttttgctgttccgcgccatcatggggctggccgaggggccgatcctg
ccgctctcccagtcgctgatggtggaagcctcctcgccccatcgccggggcctgaacatg
ggcctgctgcaagggtcggcggcgggcctgttgggcgcggtgatcggcccgccggtgctg
atcgccctggccgaagcctacggctggcgccacgccttcatcatttcgctgattcccggg
ctactgatcgccctgctgatctggcgctacgtgcagcccgacccaccgcgacacgaaccg
cgagcgcacaccccgtccagcccgggtggcagccatcgcctggccctgctcaagagccgc
aacatcgtgctctgcaccctcatcagctgcgtgttcctgacctggttcatcatcctgatt
tccttcaccccgaccttcctggtcaaggttcgcgactacagcccggccagcatgggcacg
gtgatgagctgcctgggaggcgcctgggtgctctggggcttcggcgtgccggcaatctcc
gaccgcctcggccggcgcccgaccctggtgctgttctcgctgattgccgcttgctgtccc
atcgccctgctctacgcctcgtcgccctggatgctcggggtgctgatgctgctgacctac
accggcctgggctgcttcaccctgttcatggccaccatccccgcggaaaccgtgccccgc
gaagtcatggccacggccctgggcatgatcatgggcatcggcgagctggtgggcggcttc
atcgctccgaccattgccggcttcgccgccgatcgcttcggcctgtcgatcgtcatgtgg
atgtcctgcggcggcgcattgctggccgccgtgctggccctgttcctcaaggaaaccgcc
cccgcagtactggcccgccaacaacgccggcaccccggccccaaccctgcacccagcccg
agcctggaaggaaacccatga

DBGET integrated database retrieval system