KEGG   Pseudomonas protegens Pf-5: PFL_3365Help
Entry
PFL_3365          CDS       T00249                                 

Definition
(GenBank) putative (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PFL_3365
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PFL_3365
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PFL_3365
    1.1.1.-  
     PFL_3365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DZR
Motif
Other DBs
NCBI-ProteinID: AAY92634
UniProt: Q4KBB3
LinkDB All DBs
Position
3885856..3886923
Genome map
AA seq 355 aa AA seqDB search
MIKALQWHAARDLRLTQLEPRQPGPGEVLLQVAYCGICGSDLHEYADGPHSIPQQVANPL
SGCRAPLTLGHEFCGQVVALGPGVDARLLGQRVAVEPEYRCGECSYCQMGQYNLCESMGF
IGLMGDGGFAEQAVVPAYMLHLLPDSVSFKQAAVLEPAAVAYHALNQSSLMAGDSCAVFG
LGPIGLLLVLLARLRGVERIYAVDLDPERRRLALEFGASEALDGADPQLQARLRQLSAGG
IDSAFEAAGSQQTLSHALHCLRKGGEAVLVGLMGDVQFDAFHLVNNELRLLGSVGYRHVY
PELIQLLASGRLDLSRAVTRCLTLEQAVEQGFQALLQDKSQIKVLVNPTPALADA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagcactgcaatggcatgccgcccgcgacctgcgcctgactcagctggaaccg
cgccagcccggccccggcgaggtgctgctgcaagtcgcctactgcggcatctgcggcagc
gacctgcatgagtacgccgacggccctcactccatacctcagcaggtggctaacccgctg
tccggttgccgggcgccgctgaccctgggccacgagttctgcggccaggtagtagccttg
ggcccgggcgtggatgcacggctattgggccagcgggtggcggtggaacccgaataccgc
tgcggcgagtgctcgtactgccagatgggccagtacaacctctgtgaatccatgggcttt
atcggcctgatgggcgacggcggctttgccgaacaggcggtggtaccggcctacatgctg
cacctgctgccggacagcgtcagcttcaagcaggcggccgtgctggagccggcagcggtg
gcctaccacgccttgaaccagagcagcctgatggccggcgacagttgcgcggtgttcggc
ctggggcccatcggcctgctgctggtgctactggcacggttgcgaggggtggaacggatc
tacgccgtggacctggaccccgagcgccggcgcctggccctggagttcggcgcctctgag
gccctggacggcgccgacccgcaactgcaggcacgcctgcggcagctgagcgccggtggt
atcgacagcgcctttgaggccgccggcagccagcagaccctgagccatgccctgcactgc
ctgcgcaagggcggcgaagcggtgctggtgggcttgatgggcgacgtgcagttcgatgcc
ttccacctggtgaacaacgagttgcgcctgctcggcagcgtcggctaccgccacgtctac
cccgaactgatccagctgctggccagcgggcgcctggacctgagccgggcggtcacccgc
tgcctgaccctggaacaggcggtggagcaaggcttccaggcgctgttgcaagacaagagc
cagatcaaggtgctggtcaacccgaccccggccctggccgatgcctga

DBGET integrated database retrieval system