KEGG   Pseudomonas protegens Pf-5: PFL_3977Help
Entry
PFL_3977          CDS       T00249                                 

Gene name
aceE_1
Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring), homodimeric type
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl00010  Glycolysis / Gluconeogenesis
pfl00020  Citrate cycle (TCA cycle)
pfl00620  Pyruvate metabolism
pfl01100  Metabolic pathways
pfl01110  Biosynthesis of secondary metabolites
pfl01120  Microbial metabolism in diverse environments
pfl01130  Biosynthesis of antibiotics
pfl01200  Carbon metabolism
Module
pfl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFL_3977 (aceE_1)
   00020 Citrate cycle (TCA cycle)
    PFL_3977 (aceE_1)
   00620 Pyruvate metabolism
    PFL_3977 (aceE_1)
Enzymes [BR:pfl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     PFL_3977 (aceE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AAY93241
UniProt: Q4K9K6
LinkDB All DBs
Position
4591397..4594072
Genome map
AA seq 891 aa AA seqDB search
MTQNNSATLDNDPQETREWLDSLESVLTVEGRPRAHYLIDQLLDFDVARHGDFHGRVTTP
YINTIAPERQLPYPGDLETERKLNAMIRWNAMAMVLRAGKHSGVGGHIATYASAAVLYDV
GFDHFFRGRSDSFDGDMVYIQGHSSPGIYGRAYLEGRISAAQLDNFRREADGQGISSYPH
PRLMPDFWQFPTVSMGLGPITAAYQARFMRYLELRGLKQHQGRKVWAFLGDGEMDQPESL
AAISLAGREKLDNLIFVVNCNLQRLDGPVRGNAKVIQEFESLYRAAGWNVIKVIWGSGWD
ALLEKDRSGLLRQRMMECVDGDYQNYKSQNGAYVREHFFGKYPQLLELVADLSDEQIWKL
SRGGHDPLKVYNAYAAAVRHSGRPTVILAKTVKGFGMGEAGEGQNINHQLKKMGAEAVKA
FRDRFELPVSDEQLAEMPYLKPTADSTEGRYFAACRSRLGGYVPARYNDCAPLQIPALEA
FATQLKDTGDRAISTTMAFVRILGTLLKDPQIGKRVVPIVPDESRTFGMESLFRQIGIHS
AVGQLYTPQDAGQLSYYKESKDGQIMQEGLNESGAISSWIAASTSYSNHQVMTLPFYIFY
SMFGFQRIGDLAWAAGDARARGFLLGATSGRTTLMGEGLQHDDGHSHILASVIPCCISYD
PTFAYELAVIIHEGMQRMYVQQEDVYYYITLLNENYPQPAMPEGAREGILRGLYRFSSST
AQGAKAPRVQLMGSGSILREVIAAGQLLEKDFGVQSDIWSATSLTELRRQGLAAERWNLL
HPQQPRRAAYVEQCLEGHQGPLVVATDYMKLFADQIRPFVEGRRFVALGTDGFGQSDTRE
NLRQLFEVDRHFIALAALKALADDGEIPYSQVGEALSRYRIDAEKVDPSSV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaacaacagtgcaaccctcgataacgatccccaggaaacccgcgagtggctc
gactctctggagtcggtgctgacggtggaaggtcgcccgcgggcccattacctgatcgac
cagttgctggatttcgacgtggcacgccacggcgacttccatggccgggtgaccacgccc
tacatcaacaccattgcccccgagcggcagctgccctaccccggcgacctggagaccgag
cgcaagctcaacgcgatgatccgctggaacgccatggccatggtgctgcgcgccggcaag
cattcgggcgtgggcggccacatcgccacctatgcttcggcagccgtgctctacgacgtg
ggtttcgatcattttttccgcggccgcagcgacagcttcgacggtgacatggtgtacatc
cagggccactcctccccaggcatctacggccgcgcctacctggaaggacggatcagcgcc
gcccagctcgacaacttccgccgcgaggccgacggccagggaatttcctcctatccgcac
cccaggctgatgccggacttctggcagttccccactgtgtccatgggcctggggccgatc
accgcggcctatcaggcgcgtttcatgcgctacctggaactgcgcgggctcaagcagcac
caagggcgcaaggtctgggccttcctcggcgacggcgaaatggaccagcccgaatccctg
gcggcgatttccctggccgggcgggagaaactcgacaacctgatcttcgtcgtcaactgc
aacctgcaacgcctcgatggcccggtacggggcaacgccaaggtcatccaggagttcgaa
agcctgtatcgcgccgccggctggaacgtgatcaaggtgatctggggcagcggctgggac
gcgctgctggagaaggaccgcagcggcctgctgcgccagcgcatgatggagtgcgtggat
ggcgactatcagaactacaagtcgcagaacggcgcctatgtacgcgagcatttcttcggc
aagtacccgcaattgctggagctggtggccgatctctcggacgagcagatctggaagctc
tcccggggcggccacgacccgctcaaggtctacaacgcctatgccgccgcagtacgccac
agcggccggcccacggtgatcctggcgaaaaccgtcaagggcttcggcatgggcgaggcc
ggcgaaggccagaacatcaaccaccagctgaagaagatgggggccgaggcagtgaaggcc
ttccgtgatcgcttcgaactgccggtcagcgatgagcaactggctgaaatgccctacctc
aagcccacggcggacagcacggaaggccgttacttcgcagcctgtcgcagccgcctgggg
ggctatgtgccggctcgctacaacgactgcgcaccgctgcagatcccggccctggaagcc
ttcgccacccagctcaaggacaccggcgaccgggcgatctccaccaccatggccttcgtg
cgcatcctcggcaccctgctcaaggacccgcagatcggcaagcgggtggtgccgatcgtg
cctgacgagtcgcgcaccttcggcatggaaagcctgttccgccagatcggcatccactcg
gcggtgggccagctctataccccacaggatgccgggcaactgagctactacaaggagagc
aaggacggccagatcatgcaggagggcctgaacgaatccggggcgatttcctcatggatc
gccgccagtacctcctacagcaaccaccaggtcatgaccctgcccttctacatcttctat
tcgatgttcggcttccaaaggatcggtgacctggcctgggccgccggcgatgcgcgggcc
cggggcttcctgctgggcgccacgtccgggcgcaccacgctgatgggcgaaggcctgcag
cacgacgacggccacagccatatcctcgcctcggtgatcccctgctgcatctcctacgac
ccgaccttcgcctatgaactggcggtgatcatccatgaaggcatgcagcgcatgtatgtg
cagcaggaggatgtgtattactacatcaccctgctcaacgaaaactacccgcaaccggcc
atgcccgaaggtgctcgcgaaggcattctcaggggcttgtaccgcttcagctcaagcacc
gcccagggcgccaaagccccgcgggtgcaactgatgggcagtggctcgatcctgcgcgag
gtgatcgccgccgggcagctgctggagaaggacttcggggtgcagagcgacatctggagt
gccaccagcctcaccgaactgcgccgccagggcctggcggcggagcgctggaacctgctg
catccgcagcagcctcggcgagcggcctatgtcgagcaatgcctggaaggccatcaaggc
ccgctggtggtggccaccgactacatgaaactgttcgccgaccagatccgccccttcgtc
gagggtcggcgcttcgtcgccctgggcaccgacggcttcggccagtccgatacccgggaa
aacctgcggcagttgttcgaggtggaccggcatttcatcgccctggcggcgttgaaagcc
ctggccgatgacggggagataccctacagccaggtcggcgaagccttgagccgctatcgg
atcgacgctgaaaaagtcgacccgagctcggtctag

DBGET integrated database retrieval system