KEGG   Pseudomonas protegens Pf-5: PFL_4053Help
Entry
PFL_4053          CDS       T00249                                 

Gene name
ampR
Definition
(GenBank) transcriptional activator AmpR
  KO
K17850  LysR family transcriptional regulator, regulator of gene expression of beta-lactamase
Organism
pfl  Pseudomonas protegens Pf-5
Pathway
pfl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PFL_4053 (ampR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pfl03000]
    PFL_4053 (ampR)
Transcription factors [BR:pfl03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    PFL_4053 (ampR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: AAY93314
UniProt: Q4K9D3
LinkDB All DBs
Position
complement(4665458..4666333)
Genome map
AA seq 291 aa AA seqDB search
MLRPHLPLNALRAFEASARHLSFTRAAIELCVTQAAVSHQVKSLEAQLNVTLFKRLPRGL
MLTSEGETLLPVLRECFDRIAQTLGRFEGGHYREVLTVGAVGTFAVGWLLPRLEDFQARH
PYVDLRLSTNNNRVDVAAEGLDYAIRFGTGAWHGIEALALLQAPLSVLCVPELARQLHSP
ADLLGQTLLRSYRTDEWPQWFQAAGLGANSLLPQSVVFDSSLGMLEAALQGLGVALAPPL
MFQRQLASGAVVQPFDIGIVTGSYWLTRLQSRAETPAMGAFKAWLLEAVAG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtccccatctgcccctgaatgcgctgcgggctttcgaagcctcggcgcggcac
ttgagtttcacccgtgcggccatcgagctgtgcgtgacccaggcggcggtcagccaccag
gtcaagagcctggaggcccagctcaacgtcaccctgttcaagcgcctgcccaggggcctg
atgctcaccagcgaaggcgagaccctgctgccggtgctgcgcgaatgcttcgaccgcatc
gcccagaccctgggacgattcgagggtgggcactatcgtgaagtgctgacggtgggcgcg
gtgggcaccttcgccgtgggctggctgctgccgcggctggaggacttccaggcacgccat
ccctatgtcgacctgcgcctgagcaccaacaataaccgggtggacgtggcggcggagggc
ctggactatgccatccgctttggcaccggggcctggcacggcatcgaggcgctggcgttg
ttgcaggcgccactgtcggtcttgtgcgtgccggaacttgcccgccagttgcacagcccg
gcggacctgctggggcagaccttgctgcgctcctaccgcaccgacgaatggccgcagtgg
ttccaggcggcggggctgggggccaacagcctgttgccccagagcgtggtcttcgactcg
tccctgggcatgctcgaagcggcgctgcaaggcctgggcgtggccctggcgccgcccttg
atgttccagcgccagttggccagtggcgcggtggtgcagcccttcgacatcggcattgtc
accggcagctactggctgacccgcctgcaatcccgggccgaaaccccggccatgggcgcg
ttcaaggcctggctgctggaagcggtggccggctag

DBGET integrated database retrieval system