KEGG   Pseudomonas protegens Pf-5: PFL_4115Help
Entry
PFL_4115          CDS       T00249                                 

Definition
(GenBank) ADP-ribosylglycohydrolase family protein
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
pfl  Pseudomonas protegens Pf-5
Brite
KEGG Orthology (KO) [BR:pfl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFL_4115
Enzymes [BR:pfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     PFL_4115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH GFA
Motif
Other DBs
NCBI-ProteinID: AAY93376
UniProt: Q4K971
LinkDB All DBs
Position
4775676..4776998
Genome map
AA seq 440 aa AA seqDB search
MPLTLTDRYRGSLLGLACGDALGTSVEFKPRGSFPPVTDLLGGGPFNLKAGQWTDDTSMA
LCLGESLLRKDGFDPADQMGRYLNWWQWGYLSATGECFDIGMTVRQALADYQEHGQPLAG
SSDPQTAGNGSLMRLAPVVLFHYPDLAQVREFAGASSRTTHGAAEAIECCQLLAGLIAKA
LDGASKQQLQRLDAQGFRESKVAALAQGNYLDKTRDQIRGNGYCVDSLEAALWCFQHSDS
YAEAVLAAANLGDDADTTAAIVGQLAGAFYGAQGIPPHWLAKLHMGEEIQAMADDLLAAA
RRRAPARPLHGSCLCKAVQYRVDRLDMPIGHCHCQTCRKAHAAAFASTAGVMREHFQWTQ
GQERLSTYESSPGKLRHFCSVCGSHLLAERPGQPHVILRVATLDDDPGQTPQVHIWTSHD
VPWLADEALQRWPEWQPSRG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaccctcaccgaccgttaccgtggcagcctgctgggcctggcctgtggcgat
gccctgggcaccagtgtggaattcaagccacggggcagtttccccccggtcaccgatctc
ttgggcggcggcccgttcaacctcaaggccggacaatggaccgacgacacctccatggcc
ctgtgcctgggggaaagcctgttgcgcaaggacggtttcgaccccgccgaccagatgggc
cgctacctcaactggtggcaatggggctacctgagcgccaccggcgaatgcttcgatatc
ggcatgacggtgcgccaggccctggccgactatcaggaacacggccagcccttggcgggc
tccagcgacccgcagaccgccggcaatggctcgctgatgcgcctggcgccggtggtgctg
ttccattaccccgacctggcccaggtccgcgagtttgccggggccagttcgcgtaccacc
cacggcgccgccgaagccatcgaatgctgccagctgttggccgggctgatcgccaaggcc
ctggacggtgccagcaagcagcaactgcaacggctcgacgcccagggctttcgcgagagc
aaggtcgcggccctggcccagggcaattacctggataaaacccgcgaccagattcgcggc
aacggctattgcgtcgactccctggaggccgcgctctggtgcttccagcacagcgacagc
tatgccgaagcagtgctggccgccgccaacctgggggacgacgccgacaccaccgccgcc
atcgtcggccagttggccggagccttctacggggcccagggcataccgccgcactggctg
gccaagctgcacatgggcgaggagatccaggccatggccgacgacctgctggccgccgcc
cggcgtcgcgcgcctgcccggccgctgcatggcagttgcctgtgcaaggcggtgcaatac
cgggtcgaccgcctggacatgcccatcggccactgccattgccagacctgccgcaaggcc
cacgccgcggcctttgcctcgaccgccggagtcatgcgcgaacacttccagtggacccag
ggccaggaacgcctgagcacctacgaatcgtccccgggcaagctgcggcacttctgctcg
gtctgcggttctcacctgctggcggagcgcccggggcagccccacgtgatcctgcgggtg
gcgaccctggacgatgatccggggcagacgccacaggtgcatatctggacctcccacgat
gtgccctggctggccgacgaagcgctgcaacgctggcccgagtggcaacccagccgcggc
tag

DBGET integrated database retrieval system